Overview

  • Product name

    Anti-gamma Adaptin antibody
    See all gamma Adaptin primary antibodies
  • Description

    Rabbit polyclonal to gamma Adaptin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Mouse gamma Adaptin aa 780-820 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQS


    Database link: P22892

  • Positive control

    • Rat brain, lung carcinoma and kidney tissues; Mouse brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent secondary antibody the recommended dilution is 1/50 - 1/200.

Target

  • Function

    Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the adaptor complexes large subunit family.
    Contains 1 GAE domain.
  • Cellular localization

    Golgi apparatus. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adapter-related protein complex 1 subunit gamma-1 antibody
    • Adaptor protein complex AP 1 gamma 1 subunit antibody
    • Adaptor protein complex AP 1 subunit gamma 1 antibody
    • Adaptor protein complex AP-1 subunit gamma-1 antibody
    • Adaptor related protein complex 1 gamma 1 subunit antibody
    • ADTG antibody
    • AP 1 complex subunit gamma 1 antibody
    • AP-1 complex subunit gamma-1 antibody
    • AP1G1 antibody
    • AP1G1_HUMAN antibody
    • CLAPG1 antibody
    • Clathrin assembly protein complex 1 gamma 1 large chain antibody
    • Clathrin assembly protein complex 1 gamma large chain antibody
    • Clathrin assembly protein complex 1 gamma-1 large chain antibody
    • Clathrin associated/assembly/adaptor protein large gamma 1 antibody
    • Gamma1 adaptin antibody
    • Gamma1-adaptin antibody
    • Golgi adaptor HA1/AP1 adaptin gamma subunit antibody
    • Golgi adaptor HA1/AP1 adaptin subunit gamma 1 antibody
    • Golgi adaptor HA1/AP1 adaptin subunit gamma-1 antibody
    • MGC18255 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling gamma Adaptin with ab217207 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat lung carcinoma tissue labeling gamma Adaptin with ab217207 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded mouse brain tissue labeling gamma Adaptin with ab217207 at 1/400 dilution overnight at 4°C, followed by a conjugated secondary for 20 minutes and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6.0) for 15 minutes; Block endogenous peroxidase by 3% hydrogen peroxide for 20 minutes; Blocking buffer (normal goat serum) at 37°C for 30 minutes.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded mouse brain tissue labeling gamma Adaptin with ab217207 at 1/400 dilution overnight at 4°C, followed by a FITC conjugated secondary antibody for 90 minutes.

    Antigen retrieval by boiling in sodium citrate buffer (pH6.0) for 15 minutes; Block endogenous peroxidase by 3% hydrogen peroxide for 20 minutes; Blocking buffer (normal goat serum) at 37°C for 30 minutes.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded rat kidney tissue labeling gamma Adaptin with ab217207 at 1/400 dilution overnight at 4°C, followed by a conjugated secondary for 20 minutes and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6.0) for 15 minutes; Block endogenous peroxidase by 3% hydrogen peroxide for 20 minutes; Blocking buffer (normal goat serum) at 37°C for 30 minutes.

References

ab217207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up