Overview

  • Product name

    Anti-gamma Adducin antibody
    See all gamma Adducin primary antibodies
  • Description

    Mouse polyclonal to gamma Adducin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Recombinant fragment
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human gamma Adducin aa 462-560. NCBI Accession No. NP_058432.
    Sequence:

    PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQ NRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG


    Database link: Q9UEY8

  • Positive control

    • K562, mouse NIH 3T3, mouse Raw 264.7 and rat PC12 cell lysates; recombinant gamma Adducin protein fragment.

Properties

Applications

Our Abpromise guarantee covers the use of ab194426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 79 kDa.

Target

  • Function

    Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.
  • Tissue specificity

    Heart only expresses isoform 1.
  • Sequence similarities

    Belongs to the aldolase class II family. Adducin subfamily.
  • Domain

    Comprised of three regions: a N-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADD3 antibody
    • ADDG_HUMAN antibody
    • ADDL antibody
    • Adducin 3 (gamma) antibody
    • Adducin 3 antibody
    • Adducin, gamma antibody
    • Adducin-like antibody
    • Adducin-like protein 70 antibody
    • Gamma-adducin antibody
    see all

Images

  • Anti-gamma Adducin antibody (ab194426) at 1/1000 dilution + recombinant Adducin protein fragment at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 79 kDa

  • Anti-gamma Adducin antibody (ab194426) at 1/500 dilution + rat PC12 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 79 kDa

  • Anti-gamma Adducin antibody (ab194426) at 1/500 dilution + mouse Raw 264.7 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 79 kDa

  • Anti-gamma Adducin antibody (ab194426) at 1/500 dilution + mouse NIH 3T3 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 79 kDa

  • Anti-gamma Adducin antibody (ab194426) at 1/500 dilution + K562 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 79 kDa

References

ab194426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up