Overview

  • Product name

    Anti-gamma Catenin antibody [CTNG/1664]
    See all gamma Catenin primary antibodies
  • Description

    Mouse monoclonal [CTNG/1664] to gamma Catenin
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human gamma Catenin aa 1-745.
    Sequence:

    MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACG RQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSL LLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKL LNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD TARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTL HNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE AGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQL SVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDD ITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKA TIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPY TDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLF RISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDAT YRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA


    Database link: P14923

  • Positive control

    • IHC-P: Human prostate and cervical carcinoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    CTNG/1664
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab218437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.1 - 0.2 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

(for 30 minutes at RT)

Target

  • Function

    Common junctional plaque protein. The membrane-associated plaques are architectural elements in an important strategic position to influence the arrangement and function of both the cytoskeleton and the cells within the tissue. The presence of plakoglobin in both the desmosomes and in the intermediate junctions suggests that it plays a central role in the structure and function of submembranous plaques. Acts as a substrate for VE-PTP and is required by it to stimulate VE-cadherin function in endothelial cells. Can replace beta-catenin in E-cadherin/catenin adhesion complexes which are proposed to couple cadherins to the actin cytoskeleton.
  • Involvement in disease

    Defects in JUP are the cause of Naxos disease (NXD) [MIM:601214]. NXD is an autosomal recessive disorder combining diffuse non-epidermolytic palmoplantar keratoderma with arrhythmogenic right ventricular dysplasia/cardiomyopathy and woolly hair.
    Defects in JUP are the cause of familial arrhythmogenic right ventricular dysplasia type 12 (ARVD12) [MIM:611528]; also called arrhythmogenic right ventricular cardiomyopathy 12 (ARVC12). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.
  • Sequence similarities

    Belongs to the beta-catenin family.
    Contains 9 ARM repeats.
  • Cellular localization

    Cell junction > adherens junction. Cell junction > desmosome. Cytoplasm > cytoskeleton. Membrane. Cytoplasmic in a soluble and membrane-associated form.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARVD 12 antibody
    • ARVD12 antibody
    • Catenin (cadherin associated protein), gamma 80kDa antibody
    • catenin (cadherin-associated protein) gamma (80kD) antibody
    • Catenin gamma antibody
    • CTNNG antibody
    • Desmoplakin 3 antibody
    • Desmoplakin III antibody
    • Desmoplakin-3 antibody
    • Desmoplakin3 antibody
    • DesmoplakinIII antibody
    • DP 3 antibody
    • DP III antibody
    • DP3 antibody
    • DPIII antibody
    • gamma catenin antibody
    • Junction plakoglobin antibody
    • JUP antibody
    • OTTHUMP00000164732 antibody
    • OTTHUMP00000164735 antibody
    • OTTHUMP00000164738 antibody
    • PDGB antibody
    • PKGB antibody
    • PLAK_HUMAN antibody
    • PLAKOGLOBIN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human cervical carcinoma tissue labeling gamma Catenin with ab218437 at 0.2 µg/mL.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human prostate carcinoma tissue labeling gamma Catenin with ab218437 at 0.2 µg/mL.

References

ab218437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up