Overview

  • Product name

  • Description

    Rabbit polyclonal to GAMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GAMT aa 64-236. (Expressed in E.coli).
    Sequence:

    VLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPL KGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPG GVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMA LVPPADCRYYAFPQMITPLVTKG


    Database link: Q14353

  • Positive control

    • IHC-P: Human liver, breast cancer, kidney, stomach and prostate tissues. WB: Recombinant human GAMT protein; Human serum; Pig liver lysate; Rat liver and pancreas lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231972 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Tissue specificity

    Expressed in liver.
  • Pathway

    Amine and polyamine biosynthesis; creatine biosynthesis; creatine from L-arginine and glycine: step 2/2.
  • Involvement in disease

    Defects in GAMT are the cause of guanidinoacetate methyltransferase deficiency (GAMT deficiency) [MIM:612736]. GAMT deficiency is an autosomal recessive disorder characterized by developmental delay/regression, mental retardation, severe disturbance of expressive and cognitive speech, intractable seizures and movement disturbances, severe depletion of creatine/phosphocreatine in the brain, and accumulation of guanidinoacetic acid (GAA) in brain and body fluids.
  • Sequence similarities

    Belongs to the RMT2 methyltransferase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCDS2 antibody
    • Epididymis secretory protein Li 20 antibody
    • GAMT antibody
    • GAMT_HUMAN antibody
    • Guanidinoacetate N methyltransferase antibody
    • Guanidinoacetate N-methyltransferase antibody
    • HEL-S-20 antibody
    • PIG2 antibody
    • TP53I2 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for GAMT using ab231972 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-GAMT antibody (ab231972) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : Pig liver lysate
    Lane 3 : Rat liver lysate
    Lane 4 : Rat pancreas lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

  • Anti-GAMT antibody (ab231972) at 1 µg/ml + Recombinant human GAMT protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

  • Paraffin-embedded human stomach tissue stained for GAMT using ab231972 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for GAMT using ab231972 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for GAMT using ab231972 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for GAMT using ab231972 at 10 µg/ml in immunohistochemical analysis. DAB staining.

References

ab231972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up