Anti-Gankyrin antibody (ab238590)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Gankyrin antibody
See all Gankyrin primary antibodies -
Description
Rabbit polyclonal to Gankyrin -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Gankyrin aa 1-226.
Sequence:MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSA GHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVN AVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKG NLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYI ENKEEKTPLQVAKGGLGLILKRMVEG
Database link: O75832 -
Positive control
- IHC-P: Human testis and placenta tissues. ICC/IF: HeLa cells.
-
General notes
Previously labelled as Proteasome 26S S10.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238590 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/200 - 1/500. |
Target
-
Function
Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module.
Acts as an proto-oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export. -
Tissue specificity
Overexpressed in hepatocellular carcinomas. -
Sequence similarities
Contains 7 ANK repeats. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 5716 Human
- Omim: 300880 Human
- SwissProt: O75832 Human
- Unigene: 522752 Human
-
Alternative names
- 26S proteasome non-ATPase regulatory subunit 10 antibody
- 26S proteasome regulatory subunit p28 antibody
- Ankyrin repeat protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Gankyrin antibody (ab238590)Paraffin-embedded human testis tissue stained for Gankyrin using ab238590 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Gankyrin antibody (ab238590)Paraffin-embedded human placenta tissue stained for Gankyrin using ab238590 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-Gankyrin antibody (ab238590)HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Gankyrin (green) using ab238590 at 1/200 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.
References
ab238590 has not yet been referenced specifically in any publications.
