Overview

  • Product name

    Anti-Gankyrin antibody [OTI3F6]
    See all Gankyrin primary antibodies
  • Description

    Mouse monoclonal [OTI3F6] to Gankyrin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Gankyrin aa 1-226. Produced in HEK-293T cells (NP_002805).
    Sequence:

    MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSA GHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVN AVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKG NLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYI ENKEEKTPLQVAKGGLGLILKRMVEG


    Database link: O75832

  • Positive control

    • WB: HEK-293T cell lysate transfected with the pCMV6-ENTRY Gankyrin cDNA; HepG2 cell extract. Flow Cyt: HeLa and Jurkat cells.
  • General notes

    Clone OTI3F6 (formerly 3F6).

    Previously labelled as Proteasome 26S S10.

Properties

Applications

Our Abpromise guarantee covers the use of ab118009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 24 kDa.
Flow Cyt 1/100.

Target

  • Function

    Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module.
    Acts as an proto-oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.
  • Tissue specificity

    Overexpressed in hepatocellular carcinomas.
  • Sequence similarities

    Contains 7 ANK repeats.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 26S proteasome non-ATPase regulatory subunit 10 antibody
    • 26S proteasome regulatory subunit p28 antibody
    • Ankyrin repeat protein antibody
    • dJ889N15.2 antibody
    • Gankyrin antibody
    • Hepatocellular carcinoma-associated protein p28 II antibody
    • p28 antibody
    • p28(GANK) antibody
    • Proteasome (prosome, macropain) 26S subunit, non ATPase, 10 antibody
    • Proteasome 26S S10 antibody
    • PSD10_HUMAN antibody
    • Psmd10 antibody
    see all

Images

  • All lanes : Anti-Gankyrin antibody [OTI3F6] (ab118009) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T lysate transfected with pCMV6-ENTRY Proteasome 26S S10 cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 24 kDa

  • All lanes : Anti-Gankyrin antibody [OTI3F6] (ab118009) at 1/2000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : HT-29 (human colorectal adenocarcinoma cell line) cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 24 kDa

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Gankyrin (red) using ab118009 at 1/100 dilution, compared to a nonspecific negative control antibody (blue).

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling Gankyrin (red) using ab118009 at 1/100 dilution, compared to a nonspecific negative control antibody (blue).

References

ab118009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up