Overview

  • Product name

  • Description

    Rabbit polyclonal to GANP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human GANP aa 717-803.
    Sequence:

    RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEP MSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE


    Database link: O60318

  • Positive control

    • ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be involved in the nuclear localization pathway of MCM3.
  • Sequence similarities

    Belongs to the SAC3 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 80 kDa MCM3 associated protein antibody
    • 80 kDa MCM3-associated protein antibody
    • FLJ44336 antibody
    • FLJ45306 antibody
    • Germinal center associated nuclear protein antibody
    • KIAA0572 antibody
    • MAP80 antibody
    • MCM3 import protein antibody
    • MCM3 minichromosome maintenance deficient 3 associated protein antibody
    • MCM3A antibody
    • MCM3A_HUMAN antibody
    • Mcm3ap antibody
    • Minichromosome maintenance complex component 3 associated protein antibody
    • Minichromosome maintenance deficient 3 associated protein antibody
    • Minichromosome maintenance protein 3 associated protein antibody
    • Protein GANP antibody
    • SAC3 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GANP (green) using ab222058 at 4 µg/ml in ICC/IF.

References

ab222058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up