Overview

  • Product name

  • Description

    Rabbit polyclonal to GAP43
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Chimpanzee, Macaque monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human GAP43 aa 1-274. (Expressed in E.coli).
    Sequence:

    MTKSCSELCHPALHFLPCLGGLRKNLQRAVRPSPYSLGFLTFWISRVEKN DDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEA EANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKG EGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEE PKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDE TKPKESARQDEGKEEEPEADQEHA


    Database link: P17677-2

  • Positive control

    • WB: Recombinant human GAP43 protein; Rat and pig brain tissues. IHC-P: Human pancreatic cancer, glioma, breast cancer and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 mg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Function

    This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons.
  • Sequence similarities

    Belongs to the neuromodulin family.
    Contains 1 IQ domain.
  • Post-translational
    modifications

    Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity.
  • Cellular localization

    Cell membrane. Cell projection > growth cone membrane. Cell junction > synapse. Cytoplasmic surface of growth cone and synaptic plasma membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Axonal membrane protein GAP 43 antibody
    • Axonal membrane protein GAP-43 antibody
    • B 50 antibody
    • Calmodulin binding protein P 57 antibody
    • F1 antibody
    • GAP 43 antibody
    • GAP43 antibody
    • Growth Associated Protein 43 antibody
    • Growth-associated protein 43 antibody
    • Nerve Growth Related Peptide antibody
    • Nerve growth related peptide GAP43 antibody
    • NEUM_HUMAN antibody
    • Neural phosphoprotein B 50 antibody
    • Neural phosphoprotein B-50 antibody
    • Neuromodulin antibody
    • Neuron growth associated protein 43 antibody
    • PP46 antibody
    • Protein F1 antibody
    • QtrA-11580 antibody
    • QtrA-13071 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for GAP43 using ab232772 at 10μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for GAP43 using ab232772 at 10μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for GAP43 using ab232772 at 10μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for GAP43 using ab232772 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GAP43 antibody (ab232772) at 3 µg/ml + Recombinant human GAP43 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 29 kDa

  • All lanes : Anti-GAP43 antibody (ab232772) at 3 µg/ml

    Lane 1 : Rat brain tissue
    Lane 2 : Pig brain tissue

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 29 kDa

References

ab232772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up