Overview

  • Product name

    Anti-GAPR-1 antibody
  • Description

    Rabbit polyclonal to GAPR-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human GAPR-1 aa 2-73.
    Sequence:

    GKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRI LKHSPESSRGQCGENLAWASYD


    Database link: Q9H4G4

  • Positive control

    • Transfected HEK293T cell lysate.
  • General notes

    Previously labelled as GLIPR2. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250.

Target

  • Tissue specificity

    Highest expression in lung and peripheral leukocytes, and minor expression in liver and kidney.
  • Sequence similarities

    Belongs to the CRISP family.
    Contains 1 SCP domain.
  • Cellular localization

    Golgi apparatus membrane. Binds lipid-enriched microdomains of Golgi membranes not only by ionic interactions but also through the myristate.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5730414A08Rik antibody
    • C77180 antibody
    • C9orf19 antibody
    • GAPR 1 antibody
    • GAPR-1 antibody
    • GAPR1_HUMAN antibody
    • GLI pathogenesis related 2 antibody
    • Glioma pathogenesis related protein 2 antibody
    • Glioma pathogenesis-related protein 2 antibody
    • GliPR 2 antibody
    • GLIPR2 antibody
    • Golgi associated plant pathogenesis related protein 1 antibody
    • Golgi associated PR 1 protein antibody
    • Golgi-associated plant pathogenesis-related protein 1 antibody
    • Golgi-associated PR-1 protein antibody
    • OTTMUSP00000007558 antibody
    • RP11-421H8.5 antibody
    • RP23-209M8.2 antibody
    see all

Images

  • All lanes : Anti-GAPR-1 antibody (ab122059) at 1/250 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)

    Lane 2 : GAPR-1-transfected HEK293T over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa))

    Developed using the ECL technique.
  • All lanes : Anti-GAPR-1 antibody (ab122059) at 1/1000 dilution

    Lane 1 : Mouse cell lysate
    Lanes 2-3 : Human cell lysate

    Lysates/proteins at 20000000 cells per lane.

    Secondary
    All lanes : HRP-conjugated goat anti-rabbit IgG polyclonal at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Observed band size: 17 kDa
    why is the actual band size different from the predicted?


    Exposure time: 2 minutes

    See Abreview

References

ab122059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - other (N/A)
Gel Running Conditions
Reduced Denaturing
Loading amount
2e+007 cells
Specification
N/A
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 31 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up