Overview

  • Product name

  • Description

    Rabbit polyclonal to GARS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GARS aa 567-735. (Expressed in E.coli).
    Sequence:

    VEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKC SVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGV AFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITW ADVEARYPLFEGQETGKKE


    Database link: P41250

  • Positive control

    • WB: Recombinant human GARS protein: Pig stomach lysate; HepG2 cell lysate. IHC-P: Human glioma, breast cancer, prostate cancer, cerebrum, colorectal cancer, liver and stomach tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232682 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232682 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 83 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for GARS using ab232682 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for GARS using ab232682 at 30μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for GARS using ab232682 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for GARS using ab232682 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for GARS using ab232682 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for GARS using ab232682 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for GARS using ab232682 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GARS antibody (ab232682) at 2 µg/ml + Recombinant human GARS

    Predicted band size: 83 kDa

  • Anti-GARS antibody (ab232682) at 2 µg/ml + Pig stomach tissue lysate

    Predicted band size: 83 kDa

  • All lanes : Anti-GARS antibody (ab232682) at 1 µg/ml

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Pig stomach lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 83 kDa

References

ab232682 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232682.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up