Overview

  • Product name

  • Description

    Rabbit polyclonal to GAS 6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GAS 6 aa 94-164.
    Sequence:

    DCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCL CKAGWGGRLCDKDVNECSQEN


    Database link: Q14393

  • Positive control

    • U2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival during acidification by preventing apoptosis, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, or regulation of thrombotic responses.
  • Tissue specificity

    Plasma. Isoform 1 and isoform 2 are widely expressed. Isoform 1 is the predominant form in spleen.
  • Sequence similarities

    Contains 4 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 laminin G-like domains.
  • Post-translational
    modifications

    Isoform 1 is proteolytically processed after secretion to yield a N-terminal 36 kDa protein and a C-terminal 50 kDa protein including the laminin G-like domains which activates AXL.
    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AXL receptor tyrosine kinase ligand antibody
    • AXL stimulatory factor antibody
    • AXLLG antibody
    • AXS F antibody
    • AXSF antibody
    • DKFZp666G247 antibody
    • FLJ34709 antibody
    • Gas 6 antibody
    • GAS-6 antibody
    • Gas6 antibody
    • GAS6_HUMAN antibody
    • Growth arrest specific 6 antibody
    • Growth arrest-specific protein 6 antibody
    • Growth-arrest-specific protein 6 antibody
    • Growth-arrest-specific protein 6 precursor antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U2 OS cells labeling GAS 6 with ab220703 at 4 µg/ml (green).

References

ab220703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up