Overview

  • Product name
  • Description
    Rabbit polyclonal to GAS 6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GAS 6 aa 546-676.
    Sequence:

    STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQL VVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAA QLQERLAVLERHLRSPVLTFAGGLPDVPVTS


    Database link: Q14393

  • Positive control
    • IHC: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival during acidification by preventing apoptosis, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, or regulation of thrombotic responses.
  • Tissue specificity
    Plasma. Isoform 1 and isoform 2 are widely expressed. Isoform 1 is the predominant form in spleen.
  • Sequence similarities
    Contains 4 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 laminin G-like domains.
  • Post-translational
    modifications
    Isoform 1 is proteolytically processed after secretion to yield a N-terminal 36 kDa protein and a C-terminal 50 kDa protein including the laminin G-like domains which activates AXL.
    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • AXL receptor tyrosine kinase ligand antibody
    • AXL stimulatory factor antibody
    • AXLLG antibody
    • AXS F antibody
    • AXSF antibody
    • DKFZp666G247 antibody
    • FLJ34709 antibody
    • Gas 6 antibody
    • GAS-6 antibody
    • Gas6 antibody
    • GAS6_HUMAN antibody
    • Growth arrest specific 6 antibody
    • Growth arrest-specific protein 6 antibody
    • Growth-arrest-specific protein 6 antibody
    • Growth-arrest-specific protein 6 precursor antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for GAS 6 using ab223738 at 1/200 dilution in immunohistochemical analysis.

References

ab223738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up