Overview

  • Product name
  • Description
    Rabbit polyclonal to GAS2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GAS2 aa 1-313.
    Sequence:

    MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGK EITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT SAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLL ELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGN LLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMV RVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL VVSASYKAKKEIK


    Database link: O43903

  • Positive control
    • Kidney and liver cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.

Target

  • Function
    May play a role in apoptosis by acting as a cell death substrate for caspases. Is cleaved during apoptosis and the cleaved form induces dramatic rearrangements of the actin cytoskeleton and potent changes in the shape of the affected cells. May be involved in the membrane ruffling process.
  • Tissue specificity
    Ubiquitously expressed with highest levels in liver, lung, and kidney. Not found in spleen.
  • Sequence similarities
    Belongs to the GAS2 family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 GAR domain.
  • Developmental stage
    Specifically expressed at growth arrest.
  • Post-translational
    modifications
    Cleaved, during apoptosis, on a specific aspartic residue by caspases.
    Phosphorylated on serine residues during the G0-G1 transition phase.
  • Cellular localization
    Cytoplasm > cytoskeleton. Membrane. Component of the microfilament system. Colocalizes with actin fibers at the cell border and along the stress fibers in growth-arrested fibroblasts. Mainly membrane-associated. When hyperphosphorylated, accumulates at membrane ruffles.
  • Information by UniProt
  • Database links
  • Alternative names
    • GAS 2 antibody
    • GAS-2 antibody
    • Gas2 antibody
    • GAS2_HUMAN antibody
    • Growth arrest specific 2 antibody
    • Growth arrest specific protein 2 antibody
    • Growth arrest-specific protein 2 antibody
    • MGC32610 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175290. Blue DAPI for nuclear staining.
  • All lanes : Anti-GAS2 antibody (ab175290) at 1/500 dilution

    Lane 1 : kidney cell lysate
    Lane 2 : liver cell lysate

    Predicted band size: 35 kDa

References

ab175290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up