
  • Product name
    Anti-GAS41 antibody [YEATB1A8]
    See all GAS41 primary antibodies
  • Description
    Mouse monoclonal [YEATB1A8] to GAS41
  • Host species
  • Tested applications
    Suitable for: WB, Dot blotmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant human YEATS4 fragment


  • Form
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    pH: 7.40
    Preservative: 0.05% Sodium azide
    Constituents: 1% BSA, 0.812% Sodium chloride, 0.0225% Potassium chloride, 0.0204% Dibasic monohydrogen potassium phosphate, 0.1136% Dibasic monohydrogen sodium phosphate, PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    ab50963 was purified using protein G column chromatography from culture supernatant of hybridoma cultured in a medium containing bovine IgG-depleted (approximately 95%) fetal bovine serum.
  • Clonality
  • Clone number
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab50963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 27 kDa.
Dot blot Use at an assay dependent dilution.


  • Function
    Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
  • Tissue specificity
    Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
  • Sequence similarities
    Contains 1 YEATS domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • 4930573H17Rik antibody
    • B230215M10Rik antibody
    • GAS 41 antibody
    • Gas41 antibody
    • glioma amplified sequence 41 antibody
    • Glioma-amplified sequence 41 antibody
    • glioma-amplified sequence-41 antibody
    • gliomaamplified sequence 41 antibody
    • gliomaamplified sequence41 antibody
    • NUBI 1 antibody
    • NuBI-1 antibody
    • NuBI1 antibody
    • NuMA binding protein 1 antibody
    • NuMA-binding protein 1 antibody
    • YAF9 antibody
    • YEATS domain containing 4 antibody
    • YEATS domain containing4 antibody
    • YEATS domain-containing protein 4 antibody
    • YEATS4 antibody
    • YETS4_HUMAN antibody
    see all



ab50963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Abcam has not validated the combination of species/application used in this Abreview.
Western blot
Mouse Cell lysate - whole cell (cervix)
Loading amount
30 µg
Gel Running Conditions
Non-reduced Denaturing (10%)
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

Dr. Angelique Whitehurst

Verified customer

Submitted Aug 17 2011


The WB image of ab50963 was obtained by using immunogen peptide with Tag. Unfortunately, we have not obtained the data from cell lysate yet. Please refer the immunogen sequence and protocol as follows for more information. 1. Immunogen sequence HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQD PTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAA Molecular weight in the calculation is 13.5kD. 2. MW of Tag: approx. 20kDa 3. Primary Ab dilution: 1:100 4. Immunogen amount: 800ng/lane 5. Secondary Ab dilution: 1:3000 6. Secondary Ab information: Sheep Anti Mouse IgG, Original Conc.; Antibody: 0.63mg/ml, HRP : 0.78mg/ml I hope the above information is helpful for you.

Read More


Sign up