Overview

  • Product name

    Anti-Gastrokine 1 antibody
    See all Gastrokine 1 primary antibodies
  • Description

    Rabbit polyclonal to Gastrokine 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Gastrokine 1 aa 22-199. N-terminal His-tag and GST-tag; Expressed in E.coli.
    Sequence:

    AGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGW DSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQ GKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEAS LFFYSGTCYTTSVLWIVDISFCGDTVEN


    Database link: Q9NS71

  • Positive control

    • IHC-P: Human kidney, stomach, pancreas, prostate and liver tissue. WB: Recombinant human Gastrokine 1 protein; Pig and rat stomach tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
  • Tissue specificity

    Expressed in stomach. No expression is detected in cancer tissue or gastric cancer cell lines.
  • Sequence similarities

    Belongs to the gastrokine family.
    Contains 1 BRICHOS domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 18 kDa antrum mucosa protein antibody
    • AMP 18 antibody
    • AMP-18 antibody
    • AMP18 antibody
    • Antrum mucosa protein, 18-KD antibody
    • BRICD 1 antibody
    • BRICD1 antibody
    • BRICHOS domain containing 1 antibody
    • CA 11 antibody
    • CA11 antibody
    • CA11 gene antibody
    • CA11 protein antibody
    • FOV antibody
    • Foveolin antibody
    • Gastrokine-1 antibody
    • Gastrokine1 antibody
    • GKN 1 antibody
    • Gkn1 antibody
    • GKN1_HUMAN antibody
    • MGC70354 antibody
    • Protein CA11 antibody
    • UNQ489/PRO1005 antibody
    see all

Images

  • All lanes : Anti-Gastrokine 1 antibody (ab231952) at 1 µg/ml

    Lane 1 : Pig stomach tissue lysate.
    Lane 2 : Rat stomach tissue lysate.

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.
  • Anti-Gastrokine 1 antibody (ab231952) at 1 µg/ml + Recombinant human Gastrokine 1 protein.

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human liver tissue stained for Gastrokine 1 using ab231952 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Gastrokine 1 using ab231952 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Gastrokine 1 using ab231952 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Gastrokine 1 using ab231952 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Gastrokine 1 using ab231952 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab231952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up