Overview

  • Product name

    Anti-Gastrokine 3 antibody
  • Description

    Rabbit polyclonal to Gastrokine 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Gastrokine 3 aa 38-177. N-terminal tag. Expressed in E. coli.
    Sequence:

    YPLDGSVGTQTIHVDALRGVVSIRDNSVQSEWDGVMDYKNDLLAAKLFSK MACVLAKMDPAAFPSLDDITQALGKQASGHYPPTRGLTYTVLPSRIKNLA QYGVPIKDLCRAVPTYFARQQKEGTALTMDPDSCSELQLL


    Database link: Q9D0T7

  • Positive control

    • WB: Recombinant mouse Gastrokine 3 protein. Rat stomach tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 21 kDa.

Target

Images

  • Anti-Gastrokine 3 antibody (ab233523) at 2 µg/ml + Rat stomach tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 21 kDa

  • Anti-Gastrokine 3 antibody (ab233523) at 2 µg/ml + Recombinant mouse Gastrokine 3

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 21 kDa

References

ab233523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up