Overview

  • Product name
    Anti-GATA2 antibody - ChIP Grade
    See all GATA2 primary antibodies
  • Description
    Rabbit polyclonal to GATA2 - ChIP Grade
  • Host species
    Rabbit
  • Tested applications
    Suitable for: EMSA, ChIP, IHC-P, WB, IHC-Frmore details
  • Species reactivity
    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human GATA2 aa 58-107 (N terminal). The exact sequence is proprietary.
    Sequence:

    PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA


    Database link: P23769

  • Positive control
    • IHC-P: Human liver tissue. WB: K562 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab22849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
EMSA Use at an assay dependent concentration. PubMed: 20599521
ChIP Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 - 2 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-Fr 1/1000.

Target

Images

  • Anti-GATA2 antibody - ChIP Grade (ab22849) at 2 µg/ml + K562 (Human chronic myelogenous leukemia cell line from bone marrow ) cell lysate

    Predicted band size: 50 kDa
    Observed band size: 50 kDa



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin embedded sections) analysis of human liver tissue labelling GATA2 with ab22849 at a concentration of 4-8µg/ml. Arrows indicate positive labelled hepatocytes.

  • ab22849 staining GATA2 in zebrafish nervous system by Immunohistochemistry (Frozen sections).

    Tissue was fixed with paraformaldehyde and permeabilized with 0.3% Triton X-100. Samples were incubated with primary antibody (1/1000 in PBS + 0.3% Triton X-100) for 16 hours at 4°C. An AlexaFluor®555-conjugated goat anti-rabbit polyclonal IgG (1/500) was used as the secondary antibody.

    See Abreview

References

This product has been referenced in:
See all 14 Publications for this product

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (human hematopoietic progenitor cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
100 µg
Specification
human hematopoietic progenitor cells
Blocking step
BSA as blocking agent for 4 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Sep 14 2018

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Frozen sections)
Sample
Zebrafish Tissue sections (central nervous system)
Specification
central nervous system
Fixative
Paraformaldehyde
Permeabilization
Yes - PBS + 0.3 % Triton X-100

Abcam user community

Verified customer

Submitted Sep 14 2012

Answer

Thank you very much for your interest in ab22849.
To our knowledge, ab22849 has not been tested in mouse. Therefore, I can offer a discount off a future purchase if you buy ab22849 now, test it in mouse and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.
If you are interested in this offer, please follow these steps:
1. Reply to this e-mail to let me know that you would like to proceed and test ab22849 in mouse. I will then send a discount code. This code must be issued before purchasing ab22849 so please wait for my reply before ordering.
2. Purchase ab22849 either by phone, fax, or online (www.abcam.com).
3. Test it in mouse.
4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.
5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.
We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab22849 turns out to be unsuitable for mouse, you will still receive the discount on your next purchase after your Abreview has been submitted.
Please let me know if you have any questions about this offer and I would be happy to help you further.
The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
ChIP
Sample
Human Cell lysate - nuclear (Lung cancer cells)
Specification
Lung cancer cells
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: 1% Formaldehyde
Detection step
Semiquantitative PCR
Positive control
1% input total chromatin DNA.
Negative control
ChIP with beads and IgG only.

Abcam user community

Verified customer

Submitted Mar 19 2010

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (treated bone marrow cells)
Loading amount
30 µg
Specification
treated bone marrow cells
Treatment
virus
Gel Running Conditions
Reduced Denaturing (10%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Oct 01 2008

Answer

Thank you for your enquiry. We are not aware of a publication using this antibody in staining fixed tissues. The image on the datasheet is from testing the antibody, and is not published. We guarantee that our products will perform as stated on the datasheet, and since this is a tested application, we would guarantee the antibody to work in human tissue sections. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up