Overview

  • Product name
    Anti-GATA2 antibody - ChIP Grade
    See all GATA2 primary antibodies
  • Description
    Rabbit polyclonal to GATA2 - ChIP Grade
  • Host species
    Rabbit
  • Tested applications
    Suitable for: EMSA, ChIP, IHC-P, WB, IHC-Frmore details
  • Species reactivity
    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human GATA2 aa 58-107 (N terminal). The exact sequence is proprietary.
    Sequence:

    PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA


    Database link: P23769

  • Positive control
    • IHC-P: Human liver tissue. WB: K562 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab22849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
EMSA Use at an assay dependent concentration. PubMed: 20599521
ChIP Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 - 2 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-Fr 1/1000.

Target

Images

  • Anti-GATA2 antibody - ChIP Grade (ab22849) at 2 µg/ml + K562 (Human chronic myelogenous leukemia cell line from bone marrow ) cell lysate

    Predicted band size: 50 kDa
    Observed band size: 50 kDa



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin embedded sections) analysis of human liver tissue labelling GATA2 with ab22849 at a concentration of 4-8µg/ml. Arrows indicate positive labelled hepatocytes.

  • ab22849 staining GATA2 in zebrafish nervous system by Immunohistochemistry (Frozen sections).

    Tissue was fixed with paraformaldehyde and permeabilized with 0.3% Triton X-100. Samples were incubated with primary antibody (1/1000 in PBS + 0.3% Triton X-100) for 16 hours at 4°C. An AlexaFluor®555-conjugated goat anti-rabbit polyclonal IgG (1/500) was used as the secondary antibody.

    See Abreview

References

This product has been referenced in:
See all 14 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-4 of 4 Abreviews

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (human hematopoietic progenitor cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
100 µg
Specification
human hematopoietic progenitor cells
Blocking step
BSA as blocking agent for 4 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Sep 14 2018

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Frozen sections)
Sample
Zebrafish Tissue sections (central nervous system)
Specification
central nervous system
Fixative
Paraformaldehyde
Permeabilization
Yes - PBS + 0.3 % Triton X-100

Abcam user community

Verified customer

Submitted Sep 14 2012

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
ChIP
Sample
Human Cell lysate - nuclear (Lung cancer cells)
Specification
Lung cancer cells
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: 1% Formaldehyde
Detection step
Semiquantitative PCR
Positive control
1% input total chromatin DNA.
Negative control
ChIP with beads and IgG only.

Abcam user community

Verified customer

Submitted Mar 19 2010

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (treated bone marrow cells)
Loading amount
30 µg
Specification
treated bone marrow cells
Treatment
virus
Gel Running Conditions
Reduced Denaturing (10%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Oct 01 2008

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up