For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    gba-antibody-ab55080.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neurodegenerative disease Parkinson's disease Other
Share by email
Validated using a knockout cell line

Anti-GBA antibody (ab55080)

  • Datasheet
  • SDS
Reviews (3)Q&A (7)References (9)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-GBA antibody (ab55080)
  • Immunocytochemistry/ Immunofluorescence - Anti-GBA antibody (ab55080)
  • Western blot - Anti-GBA antibody (ab55080)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBA antibody (ab55080)
  • Western blot - Anti-GBA antibody (ab55080)

Key features and details

  • Mouse monoclonal to GBA
  • Suitable for: WB, IHC-P, ICC/IF
  • Knockout validated
  • Reacts with: Human
  • Isotype: IgG2a

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Protein
Product image
Recombinant Mouse GBA protein (Tagged) (ab235724)
Knockout
Product image
Human GBA knockout HeLa cell line (ab265038)

View more associated products

Overview

  • Product name

    Anti-GBA antibody
    See all GBA primary antibodies
  • Description

    Mouse monoclonal to GBA
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human GBA aa 146-236.
    Sequence:

    SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKL KIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Parkinson's disease
    • Other
    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Types of disease
    • Neurodegenerative disease
    • Metabolism
    • Types of disease
    • Cancer

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772)
    • Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777)
  • Isotype control

    • Mouse IgG2a, kappa monoclonal [MG2a-53] - Isotype control (ab18415)
  • Recombinant Protein

    • Recombinant Mouse GBA protein (Tagged) (ab235724)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab55080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Guaranteed

Tested applications are guaranteed to work and covered by our Abpromise guarantee.

Predicted

Predicted to work for this combination of applications and species but not guaranteed.

Incompatible

Does not work for this combination of applications and species.

Application Species
ICC/IF
Human
IHC-P
Human
WB
Human
Application Abreviews Notes
WB (2)
Use at an assay dependent concentration. Predicted molecular weight: 60 kDa.
IHC-P
Use at an assay dependent concentration.
ICC/IF
Use at an assay dependent concentration.
Notes
WB
Use at an assay dependent concentration. Predicted molecular weight: 60 kDa.
IHC-P
Use at an assay dependent concentration.
ICC/IF
Use at an assay dependent concentration.

Target

  • Involvement in disease

    Defects in GBA are the cause of Gaucher disease (GD) [MIM:230800]; also known as glucocerebrosidase deficiency. GD is the most prevalent lysosomal storage disease, characterized by accumulation of glucosylceramide in the reticulo-endothelial system. Different clinical forms are recognized depending on the presence (neuronopathic forms) or absence of central nervous system involvement, severity and age of onset.
    Defects in GBA are the cause of Gaucher disease type 1 (GD1) [MIM:230800]; also known as adult non-neuronopathic Gaucher disease. GD1 is characterized by hepatosplenomegaly with consequent anemia and thrombopenia, and bone involvement. The central nervous system is not involved.
    Defects in GBA are the cause of Gaucher disease type 2 (GD2) [MIM:230900]; also known as acute neuronopathic Gaucher disease. GD2 is the most severe form and is universally progressive and fatal. It manifests soon after birth, with death generally occurring before patients reach two years of age.
    Defects in GBA are the cause of Gaucher disease type 3 (GD3) [MIM:231000]; also known as subacute neuronopathic Gaucher disease. GD3 has central nervous manifestations.
    Defects in GBA are the cause of Gaucher disease type 3C (GD3C) [MIM:231005]; also known as pseudo-Gaucher disease or Gaucher-like disease.
    Defects in GBA are the cause of Gaucher disease perinatal lethal (GDPL) [MIM:608013]. It is a distinct form of Gaucher disease type 2, characterized by fetal onset. Hydrops fetalis, in utero fetal death and neonatal distress are prominent features. When hydrops is absent, neurologic involvement begins in the first week and leads to death within 3 months. Hepatosplenomegaly is a major sign, and is associated with ichthyosis, arthrogryposis, and facial dysmorphism.
    Note=Perinatal lethal Gaucher disease is associated with non-immune hydrops fetalis, a generalized edema of the fetus with fluid accumulation in the body cavities due to non-immune causes. Non-immune hydrops fetalis is not a diagnosis in itself but a symptom, a feature of many genetic disorders, and the end-stage of a wide variety of disorders.
    Defects in GBA contribute to susceptibility to Parkinson disease (PARK) [MIM:168600]. A complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability. Additional features are characteristic postural abnormalities, dysautonomia, dystonic cramps, and dementia. The pathology of Parkinson disease involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. The disease is progressive and usually manifests after the age of 50 years, although early-onset cases (before 50 years) are known. The majority of the cases are sporadic suggesting a multifactorial etiology based on environmental and genetic factors. However, some patients present with a positive family history for the disease. Familial forms of the disease usually begin at earlier ages and are associated with atypical clinical features.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 30 family.
  • Cellular localization

    Lysosome membrane. Interaction with saposin-C promotes membrane association.
  • Target information above from: UniProt accession P04062 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2629 Human
    • Omim: 606463 Human
    • SwissProt: P04062 Human
    • Unigene: 282997 Human
    • Unigene: 719930 Human
    • Alternative names

      • Acid beta glucosidase antibody
      • Acid beta-glucosidase antibody
      • Alglucerase antibody
      • Beta glucocerebrosidase antibody
      • BETA GLUCOSIDASE, ACID antibody
      • Beta-glucocerebrosidase antibody
      • betaGC antibody
      • D glucosyl N acylsphingosine glucohydrolase antibody
      • D-glucosyl-N-acylsphingosine glucohydrolase antibody
      • EC 3.2.1.45 antibody
      • GBA antibody
      • Gba protein antibody
      • GBA1 antibody
      • GC antibody
      • GCase antibody
      • GCB antibody
      • GLCM_HUMAN antibody
      • GLUC antibody
      • Glucocerebrosidase (alt.) antibody
      • Glucocerebrosidase antibody
      • GLUCOCEREBROSIDASE PSEUDOGENE antibody
      • Glucosidase beta antibody
      • Glucosidase, beta, acid antibody
      • Glucosidase, beta; acid (includes glucosylceramidase) antibody
      • Glucosylceramidase antibody
      • Imiglucerase antibody
      • Lysosomal glucocerebrosidase antibody
      • OTTHUMP00000033992 antibody
      • OTTHUMP00000033993 antibody
      see all

    Images

    • Western blot - Anti-GBA antibody (ab55080)
      Western blot - Anti-GBA antibody (ab55080)

      Lane 1: Wild-type HAP1 whole cell lysate (40 µg)
      Lane 2: GBA knockout HAP1 whole cell lysate (40 µg)
      Lane 3: MCF7 whole cell lysate (40 µg)
      Lane 4: HepG2 whole cell lysate (40 µg) 

      Lanes 1 - 4: Merged signal (red and green). Green - ab55080 observed at 70 kDa. Red - loading control, ab181602, observed at 37 kDa. 

      ab55080 was shown to specifically react with GBA in wild-type HAP1 cells along with additional cross-reactive bands. No bands were observed when GBA knockout samples were used. Wild-type and GBA knockout samples were subjected to SDS-PAGE. Ab55080 and ab181602 (Rabbit anti GAPDH loading control) were incubated overnight at 4°C at 1 ug/ml and 1/10,000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed (ab216772) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) secondary antibodies at 1/10,000 dilution for 1 hour at room temperature before imaging.

      This image was generated using the ascites version of the product.

    • Immunocytochemistry/ Immunofluorescence - Anti-GBA antibody (ab55080)
      Immunocytochemistry/ Immunofluorescence - Anti-GBA antibody (ab55080)

      ab55080 at 10 ug/ml staining GBA in human Hela cells by Immunocytochemistry/ Immunofluorescence.

      This image was generated using the ascites version of the product.

    • Western blot - Anti-GBA antibody (ab55080)
      Western blot - Anti-GBA antibody (ab55080)

      GBA antibody (ab55080) at 1ug/lane + MCF-7 cell lysate at 25ug/lane.

      This image was generated using the ascites version of the product.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBA antibody (ab55080)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBA antibody (ab55080)

      GBA antibody (ab55080) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human breast cancer.

      This image was generated using the ascites version of the product.

    • Western blot - Anti-GBA antibody (ab55080)
      Western blot - Anti-GBA antibody (ab55080)This image is a courtesy of Anonymous Abreview
      All lanes : Anti-GBA antibody (ab55080) at 1/1000 dilution

      Lane 1 : Lysate prepared from MOCK
      Lane 2 : Lysate prepared from human HN10 cells

      Lysates/proteins at 10 µg per lane.

      Secondary
      All lanes : IRDye® donkey polyclonal to mouse IgG at 1/3000 dilution

      Performed under reducing conditions.

      Predicted band size: 60 kDa
      Observed band size: 60 kDa


      Exposure time: 1 minute


      This image was generated using the ascites version of the product.

      See Abreview

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (9)

    Publishing research using ab55080? Please let us know so that we can cite the reference in this datasheet.

    ab55080 has been referenced in 9 publications.

    • Sanyal A  et al. LRRK2 Kinase Inhibition Rescues Deficits in Lysosome Function Due to Heterozygous GBA1 Expression in Human iPSC-Derived Neurons. Front Neurosci 14:442 (2020). PubMed: 32499675
    • Drews K  et al. Glucosylceramidase Maintains Influenza Virus Infection by Regulating Endocytosis. J Virol 93:N/A (2019). PubMed: 30918081
    • Dopeso-Reyes IG  et al. Glucocerebrosidase expression patterns in the non-human primate brain. Brain Struct Funct 223:343-355 (2018). IHC-FrFl . PubMed: 28835999
    • Yang C  et al. Celastrol increases glucocerebrosidase activity in Gaucher disease by modulating molecular chaperones. Proc Natl Acad Sci U S A 111:249-54 (2014). PubMed: 24351928
    • McNeill A  et al. Ambroxol improves lysosomal biochemistry in glucocerebrosidase mutation-linked Parkinson disease cells. Brain 137:1481-95 (2014). WB, ICC/IF ; Human . PubMed: 24574503
    • Bae EJ  et al. Glucocerebrosidase depletion enhances cell-to-cell transmission of a-synuclein. Nat Commun 5:4755 (2014). PubMed: 25156829
    • Tiscornia G  et al. Neuronopathic Gaucher's disease: induced pluripotent stem cells for disease modelling and testing chaperone activity of small compounds. Hum Mol Genet : (2012). WB ; Human . PubMed: 23118351
    • Lu J  et al. Histone deacetylase inhibitors prevent the degradation and restore the activity of glucocerebrosidase in Gaucher disease. Proc Natl Acad Sci U S A 108:21200-5 (2011). WB ; Human . PubMed: 22160715
    • Lu J  et al. Decreased glucocerebrosidase activity in Gaucher disease parallels quantitative enzyme loss due to abnormal interaction with TCP1 and c-Cbl. Proc Natl Acad Sci U S A : (2010). ICC/IF ; Human . PubMed: 21098288

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-10 of 10 Abreviews or Q&A

    Question

    Product code: 55080
    Inquiry: I would like to have the MSDS, possibly an Italian MSDS, about the following product: Anti-GBA ab55080. Sincerely,

    Read More

    Abcam community

    Verified customer

    Asked on Sep 24 2012

    Answer

    Thank you for contacting us and sorry for the delay in getting back to you.

    We are not able to provide SDS documents in Italian but the English version can now be accessed from the datasheet of ab55080, or you will find it attached to this email.

    I hope this has been of help If you have any further requests, please do not hesitate to contact us again.

    Read More

    Abcam Scientific Support

    Answered on Sep 24 2012

    Question

    Thank you for prompt reply.
    Can I have the english version?
    Thank you again
    Best regards

    Read More

    Abcam community

    Verified customer

    Asked on Sep 17 2012

    Answer

    Thank you for your email.

    This antibody does not have any hazardous material in it so MSDS will not make any sense. For antibodies where hazardous material is used to preserve the solution the MSDS can be downloaded from online datasheet.

    I hope this information will be helpful. Should you have any question please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Sep 17 2012

    Question

    Dear all,
    I would need of the italian version of material safety data sheet of your product Cat.n°ab55080.
    Is it avalaible?
    Thank you in advance
    Kind regards

    Read More

    Abcam community

    Verified customer

    Asked on Sep 17 2012

    Answer

    Thank you for contacting us.

    We unfortunately do not provide MSDS in Italian language. We have facility to provide MSDS in Chinese, Japanese, English, Spanish, French and German languages but not Italian.

    I hope this information is nevertheless helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Sep 17 2012

    Question

    Thank you for that information.  Actually, what we are looking for is a positive control, just to make sure that the Protein L antibody and then (on a separate experiment) the GCase antibody are working correctly.  Do you have any products that you would recommend as positive controls for the Protein L and GCase antibodies?

    Read More

    Abcam community

    Verified customer

    Asked on Apr 30 2012

    Answer

    Thank you for your response.

    A lysate ofPeptostreptococcus magnus,purified Protein L protein or recombinant Protein Lwould all be ideal positive controls for use withab63506.

    Fora positive control to use with our anti GBA antibody, ab55080. We have data on our website which shows the antibody to work withMCF-7 cell lysate and withHN10 cells. I would recommend one of those lysates for a positive control.

    I would like to encourage you to take advantage of our Abreview program. It takes just a few minutes to leave a review and you can collect Abpoints which you may redeem for Abcam products or Amazon gift cards while at the same time sharing information about the product with your colleagues worldwide. More information may be at:

    https://www.abcam.com/index.html?pageconfig=resource&rid=10332

    I hope that this information is helpful. Please let me know if you have any questions or there are other ways that Abcam may help you meet your research goals.

    Read More

    Abcam Scientific Support

    Answered on Apr 30 2012

    Question

    Hi,   We recently purchased your Anti-Protein L antibody (HRP) catalog number ab63506 and are interested in purchasing a loading control for this protein.  Could you please recommend one?

    Read More

    Abcam community

    Verified customer

    Asked on Apr 27 2012

    Answer

    Thank you for contacting us.

    When choosing a loading control it is best practice to choose housekeeping genes which will be present in your sample type. For example, in whole cell preparations beta Actin or GAPDH will be appropriate while in nuclear or mitochondrial fractions use Lamin B1 or COXIV respectively.

    These controls are excellent when you sample is eukaryotic. However, as Protein L will be from bacteria these housekeeping proteins may not be present. I have found however that GAPDH may be found in E.coli.

    I would recommend therefore that if your sample types are whole cell/membrane or cytoplasmic and are either bacterial (in the case of the Protein L antibody ab63506) or eukaryotic (as for use with anti GBA antibody ab55080) that you use our anti-GAPDH antibodies.

    We do have one anti-GAPDH product which is guaranteed to work with E.coli, Ab85760. Further information about this product may be found at the following page:

    https://www.abcam.com/GAPDH-antibody-HRP-ab85760.html


    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Apr 27 2012

    Question

    I have just ordered a antibody from abcam, the mouse monoclonal to GBA (ab55080), that you refer as reactive with human and rat. I have tested it in both species in western blotting, and in human I can detect GBA, however, the bands were very faint. In rat, on the contrary, I could not detect any bands. Can you give me some tips? Above you will find some of the conditions that I used: - 80-100 ug protein/lane. (I have used human fibroblast and in the case of sat samples, I used total homogenates of several organs.) - blocking was done with 5% skimmed milk in TBS, for 1 h at room temperature - membrane was incubated overnight with the ab55080 antibody at 4ºC (used diluitions: 1:500; 1:1000 and 1:2000 in 5% milk in TBS) - incubation with secondary antibody: 1 h at room temperature - detection with AP.  

    Read More

    Abcam community

    Verified customer

    Asked on Dec 02 2011

    Answer

    Thank you for contacting us. I am sorry to hear that ab55080 is not providing satisfactory results in WB.  Having reviewed this case, I would like to offer some suggestions to help optimize your results.  I would also appreciate if you can confirm some further details: 1.)  When you say that the detection was done with AP, did it involve ECL reagents or was the detection colorometric?  We find ECL to be much more sensitive than colorometric detection, and we use ECL for our in house WB validation.  2.)  It may help to use a lower percentage of milk in your antibody diluent.  I typically recommend 0.1 - 1 % milk in the antibody diluent because higher concentrations can prevent the antibody from binding effectively to the protein of interest.  3.)  What secondary antibody was used and at what dilution?  For weak signal, it can sometimes help to use more secondary antibody.  Should the suggestions not improve the results, please do let me know. In the event that a product is not functioning in the species and applications cited on the product datasheet (and the problem has been reported within 6 months of purchase), we would be pleased to provide a free of charge replacement, credit note, or refund. I hope this information is helpful, and I thank you for your cooperation.  

    Read More

    Abcam Scientific Support

    Answered on Dec 05 2011

    Question

    The antibody does not work after freezing it. Antibody was bought last month and it worked very well. However when frozen aliquots were tried the antibody do not work at all. Different troubleshooting steps were tried with no success. The lysates used were human cancer cell line adenocarcinoma of cardiac. The secondary and other steps are OK because it worked fine before.

    Read More

    Abcam community

    Verified customer

    Asked on Sep 14 2011

    Answer

    Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement with the order number 949227. To check the status of the order please contact our Customer Service team and reference this number. Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know. I wish you the best of luck with your research. PS: As discussed please try adding 50% Glycerol or 3% BSA before freezing these antibodies.

    Read More

    Abcam Scientific Support

    Answered on Sep 14 2011

    Western blot abreview for Anti-GBA antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Rat Tissue lysate - whole (Brain)
    Loading amount
    20 µg
    Specification
    Brain
    Gel Running Conditions
    Reduced Denaturing (10% SDS-PAGE)
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
    Read More

    Dr. Ruma Raha-Chowdhury

    Verified customer

    Submitted Sep 07 2010

    Immunohistochemistry (Frozen sections) abreview for Anti-GBA antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Frozen sections)
    Sample
    Human Tissue sections (Brain section)
    Specification
    Brain section
    Fixative
    Paraformaldehyde
    Permeabilization
    Yes - 0.1x PBS plus 0.3xTriton x
    Blocking step
    Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 24°C
    Read More

    Dr. Ruma Raha-Chowdhury

    Verified customer

    Submitted Sep 06 2010

    Western blot abreview for Anti-GBA antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Human Cell lysate - whole cell (HN10 cells)
    Loading amount
    10 µg
    Specification
    HN10 cells
    Treatment
    transfected with pcDNA-GBA
    Gel Running Conditions
    Reduced Denaturing (4-20%)
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Jun 10 2009

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.