Overview

  • Product name

  • Description

    Rabbit polyclonal to GBA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human GBA2 aa 743-913. (BC011363).
    Sequence:

    RPQSRSVMSDQCAGQWFLKACGLGEGDTEVFPTQHVVRALQTIFELNVQA FAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWEGF QTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQ QQHKKASWPKVKQGTGLRTGP


    Database link: Q9HCG7

  • Positive control

    • HeLa and HepG2 cell lysates; Human fetal colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab205064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Detects a band of approximately 98 kDa (predicted molecular weight: 104 kDa).

Target

  • Relevance

    GBA2 is a non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. It is involved in sphingomyelin generation and prevention of glycolipid accumulation. GBA2 may also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.
  • Cellular localization

    Cell membrane; Single-pass membrane protein. Note=Not localized to lipid rafts.
  • Database links

  • Alternative names

    • AD035 antibody
    • Beta glucocerebrosidase 2 antibody
    • Beta glucosidase 2 antibody
    • DKFZp762K054 antibody
    • glucosidase, beta (bile acid) 2 antibody
    • Glucosylceramidase 2 antibody
    • KIAA1605 antibody
    • MGC16895 antibody
    • NLGase antibody
    • Non lysosomal glucosylceramidase antibody
    • SPG46 antibody
    see all

Images

  • All lanes : Anti-GBA2 antibody (ab205064) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate

    Predicted band size: 104 kDa
    Observed band size: 98 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labeling GBA2 with ab205064 at 1/100 dilution.

References

ab205064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Neuroblastoma cell line Neuro2a)
Permeabilization
Yes - 0.1% PBS-Tween
Specification
Neuroblastoma cell line Neuro2a
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Formaldehyde

Massimo Aureli

Verified customer

Submitted Apr 20 2016

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Bronchial epithelial cells overexpressing GBA2)
Permeabilization
Yes - 0.1% PBS-Tween
Specification
Bronchial epithelial cells overexpressing GBA2
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Massimo Aureli

Verified customer

Submitted Apr 20 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up