Overview

  • Product name

    Anti-GBAS antibody [1B8]
    See all GBAS primary antibodies
  • Description

    Mouse monoclonal [1B8] to GBAS
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, African green monkey
  • Immunogen

    Recombinant full length protein corresponding to Human GBAS aa 1-286. (NP_001474).
    Sequence:

    MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF VRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKI HEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEF LEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMI EWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRN AAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ


    Database link: O75323

  • Positive control

    • IHC-P: Human skeletal muscle tissue. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY GBAS. WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS; HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 cell extracts; Human testis, uterus, breast, brain, liver, ovary, thyroid galnd and colon extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1B8
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/2000. Predicted molecular weight: 34 kDa.
IHC-P Use a concentration of 10 µg/ml.
ICC/IF 1/100.

Target

Images

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for GBAS using ab230672 at 10 µg/ml in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY GBAS. Cells stained for GBAS (green) using ab230672 at 1/100 dilution in ICC/IF.

  • All lanes : Anti-GBAS antibody [1B8] (ab230672) at 1/200 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 34 kDa

  • All lanes : Anti-GBAS antibody [1B8] (ab230672) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 (mouse cell line) cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 34 kDa

  • All lanes : Anti-GBAS antibody [1B8] (ab230672) at 1/200 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human uterus extract
    Lane 3 : Human breast extract
    Lane 4 : Human brain extract
    Lane 5 : Human liver extract
    Lane 6 : Human ovary extract
    Lane 7 : Human thyroid gland extract
    Lane 8 : Human colon extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 34 kDa

References

ab230672 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up