Overview

  • Product name

  • Description

    Rabbit polyclonal to GBAS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GBAS aa 24-55.
    Sequence:

    CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD


    Database link: O75323

  • Positive control

    • A-431 cells; RT-4, U-251 MG, liver and tonsil lysates; Human heart muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 34 kDa.

Target

  • Tissue specificity

    Widely expressed. Most abundant in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the NipSnap family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 nitrophenylphosphatase domain and non neuronal SNAP25 like 2 antibody
    • gbas antibody
    • Glioblastoma amplified sequence antibody
    • Glioblastoma-amplified sequence antibody
    • NIPS2_HUMAN antibody
    • Nipsnap homolog 2 antibody
    • NipSnap2 antibody
    • Protein NipSnap homolog 2 antibody
    see all

Images

  • All lanes : Anti-GBAS antibody (ab204890) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 34 kDa

  • Immunofluorescent analysis of PFA/Triton X-100 fixed and permeabilized A-431 cells labeling GBAS with ab204890 at 4 µg/ml. Antibody staining is shown in green.

  • Immunohistochemical analysis of formalin-fixed. paraffin-embedded Human heart muscle labeling GBAS with ab204890 at 1/2500.

References

ab204890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up