Anti-GBAS antibody [OTI1B8] (ab139357)
Key features and details
- Mouse monoclonal [OTI1B8] to GBAS
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-GBAS antibody [OTI1B8]
See all GBAS primary antibodies -
Description
Mouse monoclonal [OTI1B8] to GBAS -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Dog, Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human GBAS aa 1-286. Produced in E.coli (NP_001474).
Sequence:MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF VRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKI HEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEF LEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMI EWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRN AAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ
Database link: O75323 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; Human testis uterus, breast, brain, liver, ovary, thyroid gland and colon extracts. IHC-P: Human colon adenocarcinoma, kidney, ovary adenocarcinoma and endometrium adenocarcinoma tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY GBAS; HeLa cells.
-
General notes
Clone OTI1B8 (formerly 1B8).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1B8 -
Isotype
IgG1 -
Research areas
Associated products
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab139357 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/200 - 1/2000. Predicted molecular weight: 34 kDa.
|
|
IHC-P |
1/150.
|
|
ICC/IF |
1/50 - 1/100.
|
Notes |
---|
WB
1/200 - 1/2000. Predicted molecular weight: 34 kDa. |
IHC-P
1/150. |
ICC/IF
1/50 - 1/100. |
Target
-
Tissue specificity
Widely expressed. Most abundant in heart and skeletal muscle. -
Sequence similarities
Belongs to the NipSnap family. - Information by UniProt
-
Database links
- Entrez Gene: 479700 Dog
- Entrez Gene: 2631 Human
- Entrez Gene: 14467 Mouse
- Entrez Gene: 498174 Rat
- Omim: 603004 Human
- SwissProt: O75323 Human
- SwissProt: O55126 Mouse
- Unigene: 591069 Human
see all -
Alternative names
- 4 nitrophenylphosphatase domain and non neuronal SNAP25 like 2 antibody
- gbas antibody
- Glioblastoma amplified sequence antibody
see all
Images
-
All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution
Lane 1 : Human testis extract
Lane 2 : Human uterus extract
Lane 3 : Human breast extract
Lane 4 : Human brain extract
Lane 5 : Human liver extract
Lane 6 : Human ovary extract
Lane 7 : Human thyroid gland extract
Lane 8 : Human colon extract
Lysates/proteins at 10 µg per lane.
Predicted band size: 34 kDa -
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GBAS (green) using ab139357 at 1/100 dilution in ICC/IF.
-
All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 34 kDa -
All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (canine kidney cell line) cell extract
Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 34 kDa -
Paraffin-embedded human colon adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human kidney tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human ovary adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human endometrium adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GBAS stained for GBAS (green) using ab139357 at 1/50 dilution in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab139357 has not yet been referenced specifically in any publications.