Overview

  • Product name

    Anti-GBAS antibody [OTI1B8]
    See all GBAS primary antibodies
  • Description

    Mouse monoclonal [OTI1B8] to GBAS
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human GBAS aa 1-286. Produced in E.coli (NP_001474).
    Sequence:

    MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF VRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKI HEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEF LEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMI EWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRN AAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ


    Database link: O75323

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; Human testis uterus, breast, brain, liver, ovary, thyroid gland and colon extracts. IHC-P: Human colon adenocarcinoma, kidney, ovary adenocarcinoma and endometrium adenocarcinoma tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY GBAS; HeLa cells.
  • General notes

    Clone OTI1B8 (formerly 1B8).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1B8
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab139357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/2000. Predicted molecular weight: 34 kDa.
IHC-P 1/150.
ICC/IF 1/50 - 1/100.

Target

Images

  • All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human uterus extract
    Lane 3 : Human breast extract
    Lane 4 : Human brain extract
    Lane 5 : Human liver extract
    Lane 6 : Human ovary extract
    Lane 7 : Human thyroid gland extract
    Lane 8 : Human colon extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 34 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GBAS (green) using ab139357 at 1/100 dilution in ICC/IF.

  • All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 34 kDa

  • All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 34 kDa

  • Paraffin-embedded human colon adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GBAS stained for GBAS (green) using ab139357 at 1/50 dilution in ICC/IF.

References

ab139357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up