Overview

  • Product name

  • Description

    Rabbit polyclonal to GBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Mouse GBP2 aa 185-225 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LELEVNGKPVTSDEYLEHSLTLKKGADKKTKSFNEPRLCIR


    Database link: Q9Z0E6

  • Positive control

    • WB: Mouse lung tissue lysate. IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 67 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-GBP2 antibody (ab203238) at 1/300 dilution + Mouse lung lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/500 dilution

    Predicted band size: 67 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human colon cancer tissue labeling GBP2 with ab203238 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Primary murine neurons)
Permeabilization
No
Specification
Primary murine neurons
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Mar 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up