Overview

  • Product name

  • Description

    Rabbit polyclonal to GBP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse GBP4 aa 1-304. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MEAPICLVENWKNQLTVNLEAIRILEQIAQPLVVVAIVGLYRTGKSYLMN RLAGRNHGFSLGSTVQSETKGIWMWCVPHPTKPTHTLVLLDTEGLGDVEK GDPKNDSWIFALAVLLSSTFVYNSMSTINQQALEQLHFVTELTQLIRAKS SPREDKVKDSSEFVGFFPDFIWAVRDFALELKLNGRPITEDEYLENALKL IQGDNLKVQQSNMTRECIRYFFPVRKCFVFDRPTSDKRLLLQIENVPENQ LERNFQVESEKFCSYIFTNGKTKTLRGGVIVTGNRLGTLVQTYVNAINSG TVPC


    Database link: Q61107

  • Positive control

    • IHC-P: Mouse brain, testis, kidney and stomach tissues. WB: Mouse serum; Mouse placenta and pancreas lysates; Recombinant mouse GBP4 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232689 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 71 kDa.

Target

  • Function

    Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation.
  • Sequence similarities

    Belongs to the GBP family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • GBP 4 antibody
    • GBP-4 antibody
    • GBP4 antibody
    • GBP4_HUMAN antibody
    • GTP binding protein 4 antibody
    • GTP-binding protein 4 antibody
    • Guanine nucleotide binding protein 4 antibody
    • Guanine nucleotide-binding protein 4 antibody
    • Guanylate binding protein 4 antibody
    • Guanylate-binding protein 4 antibody
    • Mpa2 antibody
    see all

Images

  • Paraffin-embedded mouse brain tissue stained for GBP4 using ab232689 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for GBP4 using ab232689 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for GBP4 using ab232689 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse stomach tissue stained for GBP4 using ab232689 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GBP4 antibody (ab232689) at 1 µg/ml + Recombinant mouse GBP4 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 71 kDa

  • All lanes : Anti-GBP4 antibody (ab232689) at 1 µg/ml

    Lane 1 : Mouse serum
    Lane 2 : Mouse placenta lysate
    Lane 3 : Mouse pancreas lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 71 kDa

References

ab232689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up