Overview

  • Product name

  • Description

    Rabbit polyclonal to GBP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GBP4 aa 494-603.
    Sequence:

    KALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQEYMA QMEKKLEEERENLLREHERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQL KEKIESTKNE


    Database link: Q96PP9

  • Positive control

    • IHC-P: Human breast cancer and small intestine tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituent: 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/500.
IHC-P 1/500 - 1/1000.

Target

  • Function

    Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation.
  • Sequence similarities

    Belongs to the GBP family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • GBP 4 antibody
    • GBP-4 antibody
    • GBP4 antibody
    • GBP4_HUMAN antibody
    • GTP binding protein 4 antibody
    • GTP-binding protein 4 antibody
    • Guanine nucleotide binding protein 4 antibody
    • Guanine nucleotide-binding protein 4 antibody
    • Guanylate binding protein 4 antibody
    • Guanylate-binding protein 4 antibody
    • Mpa2 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for GBP4 using ab237678 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human small intestine tissue stained for GBP4 using ab237678 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for GBP4 (green) using ab237678 at 1/266 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab237678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up