Overview

  • Product name

  • Description

    Rabbit polyclonal to GC-C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GC-C aa 982-1067.
    Sequence:

    EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIA NSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD


    Database link: P25092

  • Positive control

    • IHC-P: Human duodenum tissue.
  • General notes

    Previously labelled as GUCY2C. 

Properties

Applications

Our Abpromise guarantee covers the use of ab122404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.
  • Sequence similarities

    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GC-C antibody
    • Guanylyl cyclase C antibody
    • GUC2C antibody
    • GUC2C_HUMAN antibody
    • GUCY2C antibody
    • Heat stable enterotoxin receptor antibody
    • Heat-stable enterotoxin receptor antibody
    • hSTAR antibody
    • Intestinal guanylate cyclase antibody
    • STA receptor antibody
    see all

Images

  • Immunohistochemical analysis of human duodenum tissue labeling GC-C with ab122404 at 1/500 dilution.

References

ab122404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HCT116 and HEK293 cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
HCT116 and HEK293 cells
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 4% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Aug 21 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up