Overview

  • Product name
    Anti-GCM1 antibody - C-terminal
    See all GCM1 primary antibodies
  • Description
    Rabbit polyclonal to GCM1 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GCM1 aa 303-434 (C terminal).
    Sequence:

    LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGC PPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYS LPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP


    Database link: Q9NP62

  • Positive control
    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab187860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer.
  • Tissue specificity
    Placenta specific.
  • Sequence similarities
    Contains 1 GCM DNA-binding domain.
  • Post-translational
    modifications
    Polyubiquitinated in the presence of UBE2D2 and FBXW2 (in vitro).
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Chorion specific transcription factor GCMa antibody
    • Chorion-specific transcription factor GCMa antibody
    • GCM 1 antibody
    • GCM A antibody
    • GCM motif protein 1 antibody
    • Gcm1 antibody
    • GCM1_HUMAN antibody
    • Gcm1rs1 antibody
    • GCMA antibody
    • Gcmrs2 antibody
    • Glial cells missing homolog 1 antibody
    • Glial cells missing homolog a antibody
    • Glide antibody
    • hGCMa antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling GCM1 with ab187860 at 1/50 dilution.

References

ab187860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up