Overview

  • Product name

    Anti-GCM1 antibody - C-terminal
    See all GCM1 primary antibodies
  • Description

    Rabbit polyclonal to GCM1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GCM1 aa 303-434 (C terminal).
    Sequence:

    LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGC PPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYS LPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP


    Database link: Q9NP62

  • Positive control

    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab187860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer.
  • Tissue specificity

    Placenta specific.
  • Sequence similarities

    Contains 1 GCM DNA-binding domain.
  • Post-translational
    modifications

    Polyubiquitinated in the presence of UBE2D2 and FBXW2 (in vitro).
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chorion specific transcription factor GCMa antibody
    • Chorion-specific transcription factor GCMa antibody
    • GCM 1 antibody
    • GCM A antibody
    • GCM motif protein 1 antibody
    • Gcm1 antibody
    • GCM1_HUMAN antibody
    • Gcm1rs1 antibody
    • GCMA antibody
    • Gcmrs2 antibody
    • Glial cells missing homolog 1 antibody
    • Glial cells missing homolog a antibody
    • Glide antibody
    • hGCMa antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling GCM1 with ab187860 at 1/50 dilution.

References

ab187860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Trophoblast Stem Cell (TSC))
Permeabilization
Yes - 0.1% Triton/PBS
Specification
Trophoblast Stem Cell (TSC)
Blocking step
3% Serum/1%BSA/0.1% Triton/PBS as blocking agent for 18 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 4°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 21 2018

Application
Western blot
Sample
Human Cell lysate - whole cell (Placental and non-placental cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
10000 cells
Specification
Placental and non-placental cells
Blocking step
Odyssey Blocking Buffer (Licor) as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Oct 04 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up