Anti-GCM1 antibody [OTI4H6] (ab236388)
Key features and details
- Mouse monoclonal [OTI4H6] to GCM1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-GCM1 antibody [OTI4H6]
See all GCM1 primary antibodies -
Description
Mouse monoclonal [OTI4H6] to GCM1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human GCM1 aa 1-436. Produced in E.coli (NP_003634).
Sequence:MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK NAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAI CDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKG EHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQG SLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDL TDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKN AALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKT GCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQ YSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR
Database link: Q9NP62 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GCM1 cDNA for 48 hours.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI4H6 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab236388 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000. Predicted molecular weight: 49 kDa. |
Target
-
Function
Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer. -
Tissue specificity
Placenta specific. -
Sequence similarities
Contains 1 GCM DNA-binding domain. -
Post-translational
modificationsPolyubiquitinated in the presence of UBE2D2 and FBXW2 (in vitro). -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 8521 Human
- Omim: 603715 Human
- SwissProt: Q9NP62 Human
- Unigene: 28346 Human
-
Alternative names
- Chorion specific transcription factor GCMa antibody
- Chorion-specific transcription factor GCMa antibody
- GCM 1 antibody
see all
Images
-
All lanes : Anti-GCM1 antibody [OTI4H6] (ab236388) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hours
Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY GCM1 cDNA for 48 hours
Predicted band size: 49 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab236388 has not yet been referenced specifically in any publications.