For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    gcm1-antibody-oti4h6-ab236388.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Other factors
Share by email

Anti-GCM1 antibody [OTI4H6] (ab236388)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-GCM1 antibody [OTI4H6] (ab236388)

    Key features and details

    • Mouse monoclonal [OTI4H6] to GCM1
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG1

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-GCM1 antibody [OTI4H6]
      See all GCM1 primary antibodies
    • Description

      Mouse monoclonal [OTI4H6] to GCM1
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
    • Immunogen

      Recombinant full length protein corresponding to Human GCM1 aa 1-436. Produced in E.coli (NP_003634).
      Sequence:

      MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK NAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAI CDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKG EHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQG SLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDL TDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKN AALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKT GCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQ YSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR


      Database link: Q9NP62
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GCM1 cDNA for 48 hours.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: PBS, 1% BSA, 50% Glycerol
    • Concentration information loading...
    • Purity

      Affinity purified
    • Purification notes

      Purified from cell culture supernatant.
    • Clonality

      Monoclonal
    • Clone number

      OTI4H6
    • Isotype

      IgG1
    • Research areas

      • Epigenetics and Nuclear Signaling
      • Transcription
      • Other factors
      • Epigenetics and Nuclear Signaling
      • Transcription
      • Transcription Factors
      • Epigenetics and Nuclear Signaling
      • Chromatin Binding Proteins
      • DNA / RNA binding
      • Developmental Biology
      • Reproduction
      • Placental development

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)

    Applications

    Our Abpromise guarantee covers the use of ab236388 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/2000. Predicted molecular weight: 49 kDa.

    Target

    • Function

      Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer.
    • Tissue specificity

      Placenta specific.
    • Sequence similarities

      Contains 1 GCM DNA-binding domain.
    • Post-translational
      modifications

      Polyubiquitinated in the presence of UBE2D2 and FBXW2 (in vitro).
    • Cellular localization

      Nucleus.
    • Target information above from: UniProt accession Q9NP62 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 8521 Human
      • Omim: 603715 Human
      • SwissProt: Q9NP62 Human
      • Unigene: 28346 Human
      • Alternative names

        • Chorion specific transcription factor GCMa antibody
        • Chorion-specific transcription factor GCMa antibody
        • GCM 1 antibody
        • GCM A antibody
        • GCM motif protein 1 antibody
        • Gcm1 antibody
        • GCM1_HUMAN antibody
        • Gcm1rs1 antibody
        • GCMA antibody
        • Gcmrs2 antibody
        • Glial cells missing homolog 1 antibody
        • Glial cells missing homolog a antibody
        • Glide antibody
        • hGCMa antibody
        see all

      Images

      • Western blot - Anti-GCM1 antibody [OTI4H6] (ab236388)
        Western blot - Anti-GCM1 antibody [OTI4H6] (ab236388)
        All lanes : Anti-GCM1 antibody [OTI4H6] (ab236388) at 1/2000 dilution

        Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hours
        Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY GCM1 cDNA for 48 hours

        Predicted band size: 49 kDa

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab236388? Please let us know so that we can cite the reference in this datasheet.

      ab236388 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      Immunocytochemistry/ Immunofluorescence abreview for Anti-GCM1 antibody [OTI4H6]

      Average
      Abreviews
      Abreviews
      abreview image
      Application
      Immunocytochemistry/ Immunofluorescence
      Sample
      Human Cell (Trophoblast Stem Cell (TSC))
      Permeabilization
      Yes - 0.1% Triton/PBS
      Specification
      Trophoblast Stem Cell (TSC)
      Blocking step
      3% Serum/1% BSA/0.1% Triton/PBS as blocking agent for 18 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 4°C
      Fixative
      Paraformaldehyde
      Read More

      Abcam user community

      Verified customer

      Submitted Dec 21 2018

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.