Overview

  • Product name

  • Description

    Rabbit polyclonal to GCM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human GCM2 aa 20-208.
    Sequence:

    SWDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMRNT NNHNGHILKKSCLGVVVCTQACTLPDGSRLQLRPAICDKARLKQQKKACP NCHSALELIPCRGHSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETE ARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNI


    Database link: O75603

  • Positive control

    • A431 cell line lysate, human fetal brain tissue lysate and human fetal testis tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL sterile distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 57 kDa.

Target

  • Relevance

    Gcm2, a mouse ortholog of the Drosophila Glial Cells Missing gene, is expressed in the parathyroid-specific domains in the 3rd pouches from E9.5. The null mutation of Gcm2 causes aparathyroidism in the fetal and adult mouse and has been proposed to be a master regulator for parathyroid development. During Drosophila embryogenesis Gcm2 plays a crucial role in promoting glial cell differentiation.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • chorion specific transcription factor GCMb antibody
    • Chorion-specific transcription factor GCMb antibody
    • GCM motif protein 2 antibody
    • GCMb antibody
    • Glial cells missing 2 antibody
    • glial cells missing homolog 2 (Drosophila) antibody
    • Glial cells missing homolog 2 antibody
    • glial cells missing homolog b antibody
    • glide gcm protein homolog antibody
    • glide/gcm protein homolog antibody
    • hGCMb antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded human fetal testis tissue labeling GCM2 with ab201170 at a 1/100 dilution.

  • All lanes : Anti-GCM2 antibody (ab201170) at 1/500 dilution

    Lane 1 : A431 cell line lysate
    Lane 2 : Human fetal brain tissue lysate

    Predicted band size: 57 kDa

References

ab201170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Parathyroid)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: separately, Sodium Citrate and Tris-EDTA
Permeabilization
Yes - 0.05% Triton X-100
Specification
Parathyroid
Blocking step
Serum as blocking agent for 24 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 4°C
Fixative
Paraformaldehyde

Mrs. Joelle Szendel

Verified customer

Submitted Feb 19 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up