Overview

  • Product name

  • Description

    Rabbit polyclonal to GCP-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GCP-3 aa 1-250.
    Sequence:

    MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERD EFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSL SEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQS AQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLG SRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL


    Database link: Q96CW5

  • Positive control

    • IHC-P: Human breast cancer tissue.
  • General notes

    Previously labelled as Gamma-tubulin complex component 3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab238484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the GCP family.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gamma-ring complex protein 104 kDa antibody
    • Gamma-tubulin complex component 3 antibody
    • GCP-3 antibody
    • GCP3 antibody
    • GCP3_HUMAN antibody
    • h104p antibody
    • hGCP3 antibody
    • hGrip104 antibody
    • hSpc98 antibody
    • SPBC98 antibody
    • Spc98p antibody
    • Spindle pole body protein Spc98 homolog antibody
    • TUBGCP3 antibody
    • Tubulin gamma complex associated protein 3 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for GCP-3 using ab238484 at 1/100 dilution in immunohistochemical analysis.

References

ab238484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up