Overview

  • Product name

  • Description

    Rabbit polyclonal to GCP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human GCP2 aa 38-114.
    Sequence:

    GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNG KQVCLDPEAPFLKKVIQKILDSGNKKN


    Database link: P80162

  • Positive control

    • IHC-P: Human small intestine and gastric cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Chemotactic for neutrophil granulocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C X C motif chemokine 6 antibody
    • Chemokine (C X C motif) ligand 6 antibody
    • Chemokine alpha 3 antibody
    • CKA 3 antibody
    • CKA-3 antibody
    • CKA3 antibody
    • CXCL 6 antibody
    • CXCL6 antibody
    • CXCL6_HUMAN antibody
    • GCP 2 antibody
    • GCP-2 antibody
    • Granulocyte chemotactic protein 2 antibody
    • N-processed variant 3 antibody
    • SCYB6 antibody
    • Small inducible cytokine B6 antibody
    • Small inducible cytokine subfamily B (Cys X Cys) member 6 antibody
    • Small inducible cytokine subfamily B (Cys X Cys) member b antibody
    • Small-inducible cytokine B6 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for GCP2 using ab238717 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for GCP2 using ab238717 at 1/100 dilution in immunohistochemical analysis.

References

ab238717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up