Overview

  • Product name

  • Description

    Rabbit polyclonal to GCP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human GCP4 aa 203-309.
    Sequence:

    FFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQDLRLIEEENMLAP SLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSILKN QEDTFAA


    Database link: Q9UGJ1

  • Positive control

    • IHC-P: Human small intestine and testis tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/200 - 1/500.

Target

  • Relevance

    GCP4 is a component of the gamma-tubulin complex which is necessary for microtubule nucleation at the centrosome. GCP4 shows sequence identity with the C-terminal regions of human centrosomal proteins 103p (TUBGCP2) and 104p (TUBGCP3).
  • Cellular localization

    Centrosome.
  • Database links

  • Alternative names

    • 76P antibody
    • FLJ14797 antibody
    • Gamma tubulin complex component 4 antibody
    • Gamma tubulin ring complex protein (76p gene) antibody
    • Gamma tubulin ring complex protein antibody
    • Gamma-ring complex protein 76 kDa antibody
    • GCP 4 antibody
    • GCP4 antibody
    • Grip76 antibody
    • h76p antibody
    • hGCP4 antibody
    • Hgrip76 antibody
    • TUBGCP 4 antibody
    • TUBGCP4 antibody
    • Tubulin gamma complex associated protein 4 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for GCP4 using ab236971 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for GCP4 using ab236971 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for GCP4 (green) using ab236971 at 1/200 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.

References

ab236971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up