Overview

  • Product name

    Anti-GCSF Receptor antibody [8F8B12]
    See all GCSF Receptor primary antibodies
  • Description

    Mouse monoclonal [8F8B12] to GCSF Receptor
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GCSF Receptor aa 25-187. (Expressed in E.coli).
    Sequence:

    ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGR QQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPA IPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSI LDCVPKDGQSHCC


    Database link: Q99062

  • Positive control

    • WB: Recombinant human GCSF Receptor (AA: extra 25-187) protein; A431, K562, THP-1, MOLT-4, Jurkat and GCSF Receptor (AA: extra 25-187)-hIgGFc transfected HEK-293 whole cell lysate. IHC-P: Human bladder cancer tissue. Flow: Ramos cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000.

Target

  • Function

    Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
  • Tissue specificity

    One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform GCSFR-3 is highly expressed in placenta.
  • Involvement in disease

    Hereditary neutrophilia
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 114 antibody
    • CD114 antibody
    • CD114 antigen antibody
    • Colony stimulating factor 3 receptor (granulocyte) antibody
    • Colony stimulating factor 3 receptor antibody
    • CSF 3R antibody
    • CSF3R antibody
    • CSF3R_HUMAN antibody
    • Csfgr antibody
    • G CSF R antibody
    • G-CSF receptor antibody
    • G-CSF-R antibody
    • GCSFR antibody
    • Granulocyte colony stimulating factor receptor antibody
    • Granulocyte colony-stimulating factor receptor antibody
    • OTTHUMP00000009703 antibody
    • OTTHUMP00000009704 antibody
    • OTTHUMP00000009705 antibody
    see all

Images

  • Flow cytometric analysis of Ramos (human Burkitt's lymphoma cell line) cell line labeling GCSF Receptor with ab233783 at 1/200 dilution (green) compared with a negative control (red).

  • Anti-GCSF Receptor antibody [8F8B12] (ab233783) at 1/500 dilution + Recombinant human GCSF receptor (AA: extra 25-187) protein

    Developed using the ECL technique.


    Expected MW is 46.5 kDa.

  • All lanes : Anti-GCSF Receptor antibody [8F8B12] (ab233783) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : GCSF Receptor (AA: extra 25-187)-hIgGFc transfected HEK-293 whole cell lysate

    Developed using the ECL technique.
  • All lanes : Anti-GCSF Receptor antibody [8F8B12] (ab233783) at 1/500 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 3 : THP-1 (human monocytic leukemia cell line) whole cell lysate
    Lane 4 : MOLT-4 (human lymphoblastic leukemia cell line) whole cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Developed using the ECL technique.
  • Paraffin-embedded human bladder cancer tissue stained for GCSF Receptor using ab233783 at 1/200 dilution in immunohistochemical analysis. DAB staining.

References

ab233783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up