Overview

  • Product name

  • Description

    Rabbit polyclonal to GDA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Cow, Human
    Predicted to work with: Rat, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human GDA aa 1-454. Expressed in E.coli. N-terminal tags.
    Sequence:

    MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQ QEKLAKEWCFKPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLL EWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSS LLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQ KNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEA VKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAH CPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAI LINPKASDSPIDLFYGDFFGDISEAVIQKFLYLGDDRNIEEVYVGGKQVV PFSSSV


    Database link: Q9Y2T3

  • Positive control

    • WB: Recombinant human GDA protein; Human serum; HeLa cell lysate; Mouse brain and kidney lysates; Cow brain lysate. IHC-P: Human brain, liver, liver cancer and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 51 kDa.

Target

Images

  • All lanes : Anti-GDA antibody (ab233221) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : Mouse kidney lysate
    Lane 5 : Cow brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 51 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for GDA using ab233221 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal  at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for GDA using ab233221 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal  at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for GDA using ab233221 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal  at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for GDA using ab233221 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal  at 2 µg/ml. DAB staining.

  • Anti-GDA antibody (ab233221) at 1 µg/ml + Recombinant human GDA protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 51 kDa

References

ab233221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up