Overview

  • Product name

    Anti-GDF10 antibody
  • Description

    Rabbit polyclonal to GDF10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human GDF10 aa 369-478.
    Sequence:

    QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVR PSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYP NMSVDTCACR


    Database link: P55107

  • Positive control

    • WB: Rat brain tissue lysate. IHC-P: Human prostate and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 53 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human testis tissue stained for GDF10 using ab235005 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Anti-GDF10 antibody (ab235005) at 1/500 dilution + Rat brain tissue lysate.

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 53 kDa

  • Paraffin-embedded human prostate tissue stained for GDF10 using ab235005 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab235005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up