Overview

  • Product name

    Anti-GDF11 antibody [C4]
    See all GDF11 primary antibodies
  • Description

    Mouse monoclonal [C4] to GDF11
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human GDF11 aa 138-386. N-terminal His tag. Expressed in E. coli.
    Sequence:

    TTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLRPV PRPATVYLQILRLKPLTGEGTAGGGGGGRRHIRIRSLKIELHSRSGHWQS IDFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMEL RVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYK ANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFN


    Database link: O95390

  • Positive control

    • WB: Recombinant human GDF11 protein. Rat spinal cord lysate. IHC-P: Human colorectal cancer tissue.
  • General notes

     This product was previously labelled as BMP11, BMP11 + GDF8 / Myostatin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab239515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Function

    Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMP 11 antibody
    • BMP-11 antibody
    • BMP11 antibody
    • Bone morphogenetic protein 11 antibody
    • GDF 11 antibody
    • GDF-11 antibody
    • Gdf11 antibody
    • GDF11_HUMAN antibody
    • Growth differentiation factor 11 antibody
    • Growth/differentiation factor 11 antibody
    see all

Images

  • Paraffin-embedded human colorectal cancer tissue stained for GDF11 with ab239515 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GDF11 antibody [C4] (ab239515) at 3 µg/ml + Rat spinal cord lysate

    Secondary
    HRP-linked Goat Anti-Mouse IgG at 0.2 µg/ml
  • Anti-GDF11 antibody [C4] (ab239515) at 5 µg/ml + Recombinant human GDF11 protein

References

ab239515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up