Overview

  • Product name

  • Description

    Rabbit polyclonal to GDF15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GDF15 aa 30-169.
    Sequence:

    LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTD LVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSP TASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL


    Database link: Q99988

  • Positive control

    • Human placenta tissue: Human RT4 lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab211364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • GDF 15 antibody
    • GDF-15 antibody
    • Gdf15 antibody
    • GDF15_HUMAN antibody
    • Growth differentiation factor 15 antibody
    • Growth/differentiation factor 15 antibody
    • Macrophage inhibitory cytokine 1 antibody
    • MIC 1 antibody
    • Mic-1 antibody
    • MIC1 antibody
    • NAG 1 antibody
    • NAG-1 antibody
    • NAG1 antibody
    • NRG 1 antibody
    • NRG-1 antibody
    • NRG1 antibody
    • NSAID (nonsteroidal anti inflammatory drug) activated protein 1 antibody
    • NSAID antibody
    • NSAID regulated protein 1 antibody
    • NSAID-activated gene 1 protein antibody
    • NSAID-regulated gene 1 protein antibody
    • PDF antibody
    • PLAB antibody
    • Placental bone morphogenetic protein antibody
    • Placental bone morphogenic protein antibody
    • Placental TGF beta antibody
    • Placental TGF-beta antibody
    • Prostate differentiation factor antibody
    • PTGF beta antibody
    • PTGFB antibody
    see all

Images

  • All lanes : Anti-GDF15 antibody (ab211364) at 0.4 µg/ml

    Lane 1 : RT-4 cells transfected with siRNA control
    Lanes 2-3 : RT-4 cells transfected with target specific siRNA probe #1

    Predicted band size: 34 kDa

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling GDF15 with ab211364 at 1/50 dilution.

References

ab211364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up