Overview

  • Product name

  • Description

    Rabbit polyclonal to GDF7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse GDF7 aa 295-447. (Expressed in E.coli).
    Sequence:

    SRKANLGGRRRRRTALAGTRGAQGSGGGGGGGGGGGGGGGGGGGGAGRGH GRRGRSRCSRKSLHVDFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLE PTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYED MVV


    Database link: P43029-2

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Mouse heart lysate; Recombinant mouse GDF7 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 48 kDa.

Target

  • Function

    May play an active role in the motor area of the primate neocortex.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • bmp12 antibody
    • bone morphogenetic protein 12 antibody
    • GDF-7 antibody
    • Gdf7 antibody
    • GDF7_HUMAN antibody
    • growth differentiation factor 7 antibody
    • Growth/differentiation factor 7 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for GDF7 with ab231273 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GDF7 antibody (ab231273) at 2 µg/ml + Mouse heart lysate.

    Predicted band size: 48 kDa

  • Anti-GDF7 antibody (ab231273) at 2 µg/ml + Recombinant GDF7 protein.

    Predicted band size: 48 kDa

References

ab231273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up