Overview

  • Product name

  • Description

    Rabbit polyclonal to GDF7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human GDF7 aa 322-450.
    Sequence:

    TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPL DYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS PISILYIDAANNVVYKQYEDMVVEACGCR


    Database link: Q7Z4P5

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human colon cancer and lung cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 47 kDa.
IHC-P 1/100 - 1/300.

Target

  • Function

    May play an active role in the motor area of the primate neocortex.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • bmp12 antibody
    • bone morphogenetic protein 12 antibody
    • GDF-7 antibody
    • Gdf7 antibody
    • GDF7_HUMAN antibody
    • growth differentiation factor 7 antibody
    • Growth/differentiation factor 7 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for GDF7 using ab235382 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human lung cancer tissue stained for GDF7 using ab235382 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Anti-GDF7 antibody (ab235382) at 1/500 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa

References

ab235382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up