For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    gdf8--myostatin-antibody-6e4b2-ab201954.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones TGF
Share by email

Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
  • Flow Cytometry - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
  • Western blot - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)

Key features and details

  • Mouse monoclonal [6E4B2] to GDF8 / Myostatin
  • Suitable for: IHC-P, WB, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG2b

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Protein
Recombinant human GDF8 / Myostatin protein (ab50097)

View more associated products

Overview

  • Product name

    Anti-GDF8 / Myostatin antibody [6E4B2]
    See all GDF8 / Myostatin primary antibodies
  • Description

    Mouse monoclonal [6E4B2] to GDF8 / Myostatin
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Goat, Horse, Chicken, Cow, Dog, Pig
  • Immunogen

    Recombinant fragment corresponding to Human GDF8/ Myostatin aa 24-266. Recombinant fragment correspondingn to propeptide domain of human GDF8/ Myostatin expressed in E coli
    Sequence:

    NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNIS KDVIRQLLPK APPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITM PTESDFLMQVDGKPKCCFFKFS SKIQYNKVVKAQLWIYLRPVETPTTV FVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIW QSIDVKTVLQNWLK QPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKR SR R


    Database link: O14793
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human GDF8 / Myostatin (AA:24-266 ) recombinant protein; LNcap cell lysate; LNcap cells; Human cervical cancer tissue and Human liver cancer tissue.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR285002-6 are from Tissue Culture Supernatant

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    6E4B2
  • Isotype

    IgG2b
  • Research areas

    • Signal Transduction
    • Growth Factors/Hormones
    • TGF
    • Cancer
    • Growth factors
    • TGF

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG2b, kappa monoclonal [7E10G10] - Isotype Control (ab170192)
  • Recombinant Protein

    • Recombinant human GDF8 / Myostatin protein (ab50097)

Applications

Our Abpromise guarantee covers the use of ab201954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 43 kDa.
Flow Cyt 1/200 - 1/400.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Acts specifically as a negative regulator of skeletal muscle growth.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession O14793 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2660 Human
    • Entrez Gene: 17700 Mouse
    • Entrez Gene: 29152 Rat
    • Omim: 601788 Human
    • SwissProt: O14793 Human
    • SwissProt: O08689 Mouse
    • SwissProt: O35312 Rat
    • Unigene: 41565 Human
    • Unigene: 3514 Mouse
    • Unigene: 44460 Rat
    see all
  • Alternative names

    • GDF 8 antibody
    • GDF-8 antibody
    • GDF8 antibody
    • GDF8_HUMAN antibody
    • Growth differentiation factor 8 antibody
    • Growth/differentiation factor 8 antibody
    • MSLHP antibody
    • MSTN antibody
    • Myostatin antibody
    • OTTHUMP00000163498 antibody
    see all

Images

  • Western blot - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Western blot - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954) at 1/500 dilution + LNcap cell lysate

    Predicted band size: 43 kDa

  • Flow Cytometry - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Flow Cytometry - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)

    Flow cytometric analysis of LNcap cells labeling GDF8 / Myostatin using ab201954 at 1/200 dilution (green) and negative control (red).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)

    Immunohistochemical analysis of Human liver cancer tissue labeling GDF8 / Myostatin using ab201954 at 1/200 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)

    Immunohistochemical analysis of Human cervical cancer tissue labeling GDF8 / Myostatin using ab201954 at 1/200 dilution.

  • Western blot - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Western blot - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
    Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954) at 1/500 dilution + Human GDF8 / Myostatin (AA:24-266 ) recombinant protein

    Predicted band size: 43 kDa



    Expected MW is 28.9 kDa

Protocols

  • Flow cytometry protocols
  • Immunohistochemistry protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab201954? Please let us know so that we can cite the reference in this datasheet.

    ab201954 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab201954.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.