Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
Key features and details
- Mouse monoclonal [6E4B2] to GDF8 / Myostatin
- Suitable for: IHC-P, WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-GDF8 / Myostatin antibody [6E4B2]
See all GDF8 / Myostatin primary antibodies -
Description
Mouse monoclonal [6E4B2] to GDF8 / Myostatin -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, Flow Cytmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Sheep, Goat, Horse, Chicken, Cow, Dog, Pig -
Immunogen
Recombinant fragment corresponding to Human GDF8/ Myostatin aa 24-266. Recombinant fragment correspondingn to propeptide domain of human GDF8/ Myostatin expressed in E coli
Sequence:NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNIS KDVIRQLLPK APPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITM PTESDFLMQVDGKPKCCFFKFS SKIQYNKVVKAQLWIYLRPVETPTTV FVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIW QSIDVKTVLQNWLK QPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKR SR R
Database link: O14793 -
Positive control
- Human GDF8 / Myostatin (AA:24-266 ) recombinant protein; LNcap cell lysate; LNcap cells; Human cervical cancer tissue and Human liver cancer tissue.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR285002-6 are from Tissue Culture Supernatant
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6E4B2 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab201954 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/1000. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 43 kDa. | |
Flow Cyt | 1/200 - 1/400. ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
|
Target
-
Function
Acts specifically as a negative regulator of skeletal muscle growth. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 2660 Human
- Entrez Gene: 17700 Mouse
- Entrez Gene: 29152 Rat
- Omim: 601788 Human
- SwissProt: O14793 Human
- SwissProt: O08689 Mouse
- SwissProt: O35312 Rat
- Unigene: 41565 Human
see all -
Alternative names
- GDF 8 antibody
- GDF-8 antibody
- GDF8 antibody
see all
Images
-
Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954) at 1/500 dilution + LNcap cell lysate
Predicted band size: 43 kDa -
Flow cytometric analysis of LNcap cells labeling GDF8 / Myostatin using ab201954 at 1/200 dilution (green) and negative control (red).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
Immunohistochemical analysis of Human liver cancer tissue labeling GDF8 / Myostatin using ab201954 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954)
Immunohistochemical analysis of Human cervical cancer tissue labeling GDF8 / Myostatin using ab201954 at 1/200 dilution.
-
Anti-GDF8 / Myostatin antibody [6E4B2] (ab201954) at 1/500 dilution + Human GDF8 / Myostatin (AA:24-266 ) recombinant protein
Predicted band size: 43 kDaExpected MW is 28.9 kDa
Protocols
Datasheets and documents
References (0)
ab201954 has not yet been referenced specifically in any publications.