Overview

  • Product name

    Anti-GDF8 / Myostatin antibody
    See all GDF8 / Myostatin primary antibodies
  • Description

    Rabbit polyclonal to GDF8 / Myostatin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human GDF8/ Myostatin aa 300-350 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN M


    Database link: O14793

  • Positive control

    • Skeletal Muscle (Mouse) Whole Cell Lysate (ab3869) can be used as a positive control in WB. Mouse small intestine and rat heart tissues; Mouse skeletal muscle, Human muscle and C2C12 lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol

    Aqueous buffered solution.
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 43 kDa.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse small intestine tissue labeling GDF8 / Myostatin with ab203076 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat heart tissue labeling GDF8 / Myostatin with ab203076 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-GDF8 / Myostatin antibody (ab203076) at 1/200 dilution (overnight at 4°C) + Mouse skeletal muscle lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated (90 min at 37°C) at 1/3000 dilution

    Predicted band size: 43 kDa
    Observed band size: 43 kDa

  • All lanes : Anti-GDF8 / Myostatin antibody (ab203076) at 1/1000 dilution (overnight at 4°C)

    Lanes 1-2 : Human muscle lysates
    Lanes 3-4 : C2C12 cell lysates

    Predicted band size: 43 kDa

References

This product has been referenced in:

  • Xie Y  et al. Glucocorticoid-induced CREB activation and myostatin expression in C2C12 myotubes involves phosphodiesterase-3/4 signaling. Biochem Biophys Res Commun 503:1409-1414 (2018). Read more (PubMed: 30025893) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up