Overview

  • Product name

  • Description

    Rabbit polyclonal to GDI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GDI1 aa 1-274. (Expressed in E.coli).
    Sequence:

    MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLE ELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYL DFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANF DENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQ PCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYM LNKPVDDIIMENGKVVGVKSEGEV


    Database link: P31150

  • Positive control

    • WB: Pig and mouse brain lysate; U-87MG cell lysate; Recombinant human GDI1 protein. IHC-P: Human liver, breast cancer and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 51 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
  • Tissue specificity

    Brain; predominant in neural and sensory tissues.
  • Involvement in disease

    Defects in GDI1 are the cause of mental retardation X-linked type 41 (MRX41) [MIM:300104]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
    Defects in GDI1 are the cause of mental retardation X-linked type 48 (MRX48) [MIM:300104]; also known as MRX3.
  • Sequence similarities

    Belongs to the Rab GDI family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1A antibody
    • FLJ41411 antibody
    • GDI-1 antibody
    • gdi1 antibody
    • GDIA_HUMAN antibody
    • GDIL antibody
    • GDP dissociation inhibitor 1 antibody
    • Guanosine diphosphate dissociation inhibitor 1 antibody
    • Mental retardation X-linked 41 antibody
    • Mental retardation X-linked 48 antibody
    • MRX41 antibody
    • MRX48 antibody
    • Oligophrenin 2 antibody
    • Oligophrenin-2 antibody
    • OPHN2 antibody
    • Protein XAP 4 antibody
    • Protein XAP-4 antibody
    • Protein XAP4 antibody
    • Rab GDI alpha antibody
    • Rab GDP dissociation inhibitor alpha antibody
    • RABGD1A antibody
    • RABGDIA antibody
    • XAP 4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for GDI1 using ab233149 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for GDI1 using ab233149 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for GDI1 using ab233149 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-GDI1 antibody (ab233149) at 2 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : U-87MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 51 kDa

  • Anti-GDI1 antibody (ab233149) at 2 µg/ml + Recombinant human GDI1 protein

    Predicted band size: 51 kDa

References

ab233149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up