Anti-GDI1 antibody (ab236769)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GDI1 antibody
See all GDI1 primary antibodies -
Description
Rabbit polyclonal to GDI1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Dog, Chimpanzee, Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human GDI1 aa 35-170.
Sequence:RNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMAN GQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGM FEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRD
Database link: P31150 -
Positive control
- WB: A549 whole cell lysate. IHC-P: Human prostate cancer and brain tissues. ICC/IF: MCF7 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236769 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Predicted molecular weight: 51 kDa. | |
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/200 - 1/500. |
Target
-
Function
Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. -
Tissue specificity
Brain; predominant in neural and sensory tissues. -
Involvement in disease
Defects in GDI1 are the cause of mental retardation X-linked type 41 (MRX41) [MIM:300104]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
Defects in GDI1 are the cause of mental retardation X-linked type 48 (MRX48) [MIM:300104]; also known as MRX3. -
Sequence similarities
Belongs to the Rab GDI family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 450155 Chimpanzee
- Entrez Gene: 281188 Cow
- Entrez Gene: 450155 Cynomolgus monkey
- Entrez Gene: 403819 Dog
- Entrez Gene: 2664 Human
- Entrez Gene: 14567 Mouse
- Entrez Gene: 25183 Rat
- Omim: 300104 Human
see all -
Alternative names
- 1A antibody
- FLJ41411 antibody
- GDI-1 antibody
see all
Images
-
Anti-GDI1 antibody (ab236769) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 51 kDa -
MCF7 (human breast adenocarcinoma cell line) cells stained for GDI1 using ab236769 at 1/166 dilution ICC/IF.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDI1 antibody (ab236769)
Paraffin-embedded human brain tissue stained for GDI1 with ab236769 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDI1 antibody (ab236769)
Paraffin-embedded human prostate cancer tissue stained for GDI1 with ab236769 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
References
ab236769 has not yet been referenced specifically in any publications.