Overview

  • Product name

  • Description

    Rabbit polyclonal to GDI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human GDI1 aa 35-170.
    Sequence:

    RNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMAN GQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGM FEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRD


    Database link: P31150

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human prostate cancer and brain tissues. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 51 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/200 - 1/500.

Target

  • Function

    Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
  • Tissue specificity

    Brain; predominant in neural and sensory tissues.
  • Involvement in disease

    Defects in GDI1 are the cause of mental retardation X-linked type 41 (MRX41) [MIM:300104]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
    Defects in GDI1 are the cause of mental retardation X-linked type 48 (MRX48) [MIM:300104]; also known as MRX3.
  • Sequence similarities

    Belongs to the Rab GDI family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1A antibody
    • FLJ41411 antibody
    • GDI-1 antibody
    • gdi1 antibody
    • GDIA_HUMAN antibody
    • GDIL antibody
    • GDP dissociation inhibitor 1 antibody
    • Guanosine diphosphate dissociation inhibitor 1 antibody
    • Mental retardation X-linked 41 antibody
    • Mental retardation X-linked 48 antibody
    • MRX41 antibody
    • MRX48 antibody
    • Oligophrenin 2 antibody
    • Oligophrenin-2 antibody
    • OPHN2 antibody
    • Protein XAP 4 antibody
    • Protein XAP-4 antibody
    • Protein XAP4 antibody
    • Rab GDI alpha antibody
    • Rab GDP dissociation inhibitor alpha antibody
    • RABGD1A antibody
    • RABGDIA antibody
    • XAP 4 antibody
    see all

Images

  • Anti-GDI1 antibody (ab236769) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 51 kDa

  • MCF7 (human breast adenocarcinoma cell line) cells stained for GDI1 using ab236769  at 1/166 dilution ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human brain tissue stained for GDI1 with ab236769 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human prostate cancer tissue stained for GDI1 with ab236769 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up