Anti-GDI1 antibody (ab236769)
Key features and details
- Rabbit polyclonal to GDI1
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GDI1 antibody
See all GDI1 primary antibodies -
Description
Rabbit polyclonal to GDI1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Dog, Chimpanzee, Cynomolgus monkey
-
Immunogen
Recombinant fragment corresponding to Human GDI1 aa 35-170.
Sequence:RNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMAN GQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGM FEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRD
Database link: P31150 -
Positive control
- WB: A549 whole cell lysate. IHC-P: Human prostate cancer and brain tissues. ICC/IF: MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236769 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/5000. Predicted molecular weight: 51 kDa. | |
| ICC/IF | 1/50 - 1/200. | |
| IHC-P | 1/200 - 1/500. |
Target
-
Function
Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. -
Tissue specificity
Brain; predominant in neural and sensory tissues. -
Involvement in disease
Defects in GDI1 are the cause of mental retardation X-linked type 41 (MRX41) [MIM:300104]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
Defects in GDI1 are the cause of mental retardation X-linked type 48 (MRX48) [MIM:300104]; also known as MRX3. -
Sequence similarities
Belongs to the Rab GDI family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 450155 Chimpanzee
- Entrez Gene: 281188 Cow
- Entrez Gene: 450155 Cynomolgus monkey
- Entrez Gene: 403819 Dog
- Entrez Gene: 2664 Human
- Entrez Gene: 14567 Mouse
- Entrez Gene: 25183 Rat
- Omim: 300104 Human
see all -
Alternative names
- 1A antibody
- FLJ41411 antibody
- GDI-1 antibody
see all
Images
-
Western blot - Anti-GDI1 antibody (ab236769)Anti-GDI1 antibody (ab236769) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 51 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-GDI1 antibody (ab236769)MCF7 (human breast adenocarcinoma cell line) cells stained for GDI1 using ab236769 at 1/166 dilution ICC/IF.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDI1 antibody (ab236769)Paraffin-embedded human brain tissue stained for GDI1 with ab236769 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GDI1 antibody (ab236769)Paraffin-embedded human prostate cancer tissue stained for GDI1 with ab236769 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236769 has not yet been referenced specifically in any publications.
