Overview

  • Product name

    Anti-GDNF Receptor alpha 1/GFRA1 antibody
    See all GDNF Receptor alpha 1/GFRA1 primary antibodies
  • Description

    Rabbit polyclonal to GDNF Receptor alpha 1/GFRA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human GDNF Receptor alpha 1/GFRA1 aa 239-350. (Expressed in E.coli).
    Sequence:

    LNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLI GTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQ AFGNGSDVTVWQ


    Database link: P56159-2

  • Positive control

    • IHC-P: Human cerebrum tissue. WB: Recombinant human GDNF Receptor alpha 1/GFRA1 protein; Pig brain lysate.
  • General notes

     This product was previously labelled as GDNF Receptor alpha 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233444 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 51 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Receptor for GDNF. Mediates the GDNF-induced autophosphorylation and activation of the RET receptor.
  • Sequence similarities

    Belongs to the GDNFR family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GDNF family receptor alpha 1 antibody
    • GDNF family receptor alpha-1 antibody
    • GDNF R antibody
    • GDNF RA antibody
    • GDNF receptor alpha antibody
    • GDNF receptor alpha-1 antibody
    • GDNFR alpha 1 antibody
    • GDNFR alpha antibody
    • GDNFR antibody
    • GDNFR-alpha-1 antibody
    • GDNFRA antibody
    • GDNFRalpha antibody
    • GFR alpha 1 antibody
    • GFR alpha1 antibody
    • GFR-alpha-1 antibody
    • GFRA 1 antibody
    • Gfra1 antibody
    • GFRA1_HUMAN antibody
    • GFRalpha1 antibody
    • Glial cell line derived neurotrophic factor receptor alpha antibody
    • GPI linked anchor protein antibody
    • MGC23045 antibody
    • PI linked cell surface accessory protein antibody
    • RET 1L antibody
    • RET ligand 1 antibody
    • RET1L antibody
    • RETL 1 antibody
    • RETL1 antibody
    • TGF beta related neurotrophic factor receptor 1 antibody
    • TGF-beta-related neurotrophic factor receptor 1 antibody
    • TRNR 1 antibody
    • TRNR1 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human liver staining GDNF Receptor alpha 1/GFRA1 using ab233444 5 µg/mL.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human cerebrum staining GDNF Receptor alpha 1/GFRA1 using ab233444 5 µg/mL.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human kidney staining GDNF Receptor alpha 1/GFRA1 using ab233444 5 µg/mL.

  • Anti-GDNF Receptor alpha 1/GFRA1 antibody (ab233444) at 2 µg/ml + Pig brain lysate

    Predicted band size: 51 kDa

  • Paraffin-embedded human cerebrum tissue stained for GDNF Receptor alpha 1/GFRA1 using ab233444 at 20 ug/ml in immunohistochemical analysis. AEC staining.

  • Anti-GDNF Receptor alpha 1/GFRA1 antibody (ab233444) at 2 µg/ml + Recombinant human GDNF Receptor alpha 1/GFRA1 protein

    Predicted band size: 51 kDa

References

ab233444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up