Overview

  • Product name

    Anti-GDNF Receptor alpha 2/GFRA2 antibody
    See all GDNF Receptor alpha 2/GFRA2 primary antibodies
  • Description

    Rabbit polyclonal to GDNF Receptor alpha 2/GFRA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human GDNF Receptor alpha 2/GFRA2 aa 310-360 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGT D


    Database link: O00451

  • Positive control

    • Rat brain and Human placenta tissue.
  • General notes

     This product was previously labelled as GDNF Receptor alpha 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.
    Isoform 2: Participates to NRTN-induced 'Ser-727' phosphorylation of STAT3.
  • Tissue specificity

    Isoform 1 is found in both brain and placenta.
  • Sequence similarities

    Belongs to the GDNFR family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GDNF family receptor alpha 2 antibody
    • GDNF family receptor alpha-2 antibody
    • GDNF receptor alpha-2 antibody
    • GDNF receptor beta antibody
    • GDNFR beta antibody
    • GDNFR-alpha-2 antibody
    • GDNFR-beta antibody
    • GDNFRB antibody
    • GFR alpha 2 antibody
    • GFR-alpha-2 antibody
    • GFRA 2 antibody
    • Gfra2 antibody
    • GFRA2_HUMAN antibody
    • Glial cell line derived neurotrophic factor family receptor alpha2b antibody
    • Glial cell line derived neurotrophic factor receptor beta antibody
    • Neurturin receptor alpha antibody
    • NRTNR alpha antibody
    • NRTNR-alpha antibody
    • NTNR alpha antibody
    • NTNR-alpha antibody
    • NTNRA antibody
    • PI linked cell surface accessory protein antibody
    • PI linked cell-surface accessory protein antibody
    • RET ligand 2 antibody
    • RETL 2 antibody
    • RETL2 antibody
    • TGF beta related neurotrophic factor receptor 2 antibody
    • TGF-beta-related neurotrophic factor receptor 2 antibody
    • TRN receptor GPI anchored antibody
    • TRNR 2 antibody
    • TRNR2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain labeling GDNF Receptor alpha 2/GFRA2 with ab216417 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling GDNF Receptor alpha 2/GFRA2 with ab216417 at 1/200 dilution followed by Goat anti-rabbit IgG, PE conjugated, at 1/200 dilution for 40 minutes at 37°C

References

ab216417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up