Anti-GEF H1 antibody (ab185697)
Key features and details
- Rabbit polyclonal to GEF H1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-GEF H1 antibody
See all GEF H1 primary antibodies -
Description
Rabbit polyclonal to GEF H1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Dog, Pig -
Immunogen
Recombinant fragment corresponding to Human GEF H1 aa 1-350 (N terminal).
Sequence:MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGM TMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLK NNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSV STTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSE LMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQTELHH VRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLER RRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALK
Database link: Q92974 -
Positive control
- Mouse brain and lung cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab185697 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 112 kDa. | |
IHC-P | 1/50 - 1/200. |
Target
-
Function
Activates Rho-GTPases by promoting the exchange of GDP for GTP. May be involved in epithelial barrier permeability, cell motility and polarization, dendritic spine morphology, antigen presentation, leukemic cell differentiation, cell cycle regulation, and cancer. Binds Rac-GTPases, but does not seem to promote nucleotide exchange activity toward Rac-GTPases, which was uniquely reported in PubMed:9857026. May stimulate instead the cortical activity of Rac. Inactive toward CDC42, TC10, or Ras-GTPases. Forms an intracellular sensing system along with NOD1 for the detection of microbial effectors during cell invasion by pathogens. Required for RHOA and RIP2 dependent NF-kappaB signaling pathways activation upon S.flexneri cell invasion. Involved not only in sensing peptidoglycan (PGN)-derived muropeptides through NOD1 that is independent of its GEF activity, but also in the activation of NF-kappaB by Shigella effector proteins (IpgB2 and OspB) which requires its GEF activity and the activation of RhoA. -
Sequence similarities
Contains 1 DH (DBL-homology) domain.
Contains 1 PH domain.
Contains 1 phorbol-ester/DAG-type zinc finger. -
Domain
The DH (DBL-homology) domain interacts with and promotes loading of GTP on RhoA.
The PH (pleckstrin-homology) domain is involved in microtubule binding and targeting to tight junctions. -
Post-translational
modificationsPhosphorylation of Ser-886 by PAK1 induces binding to protein 14-3-3 zeta, promoting its relocation to microtubules and the inhibition of its activity. Phosphorylated by STK6 and CDK1 during mitosis, which negatively regulates its activity. Phosphorylation by MAPK1 or MAPK3 increases nucleotide exchange activity. Phosphorylation by PAK4 releases GEF-H1 from the microtubules. -
Cellular localization
Cytoplasm. Cell junction > tight junction. Golgi apparatus. Cytoplasm > cytoskeleton > spindle. Cell projection > ruffle membrane. Localizes to the tips of cortical microtubules of the mitotic spindle during cell division, and is further released upon microtubule depolymerization. Recruited into membrane ruffles induced by S.flexneri at tight junctions of polarized epithelial cells. - Information by UniProt
-
Database links
- Entrez Gene: 403498 Dog
- Entrez Gene: 9181 Human
- Entrez Gene: 16800 Mouse
- Entrez Gene: 100145887 Pig
- Entrez Gene: 310635 Rat
- Omim: 607560 Human
- SwissProt: Q865S3 Dog
- SwissProt: Q92974 Human
see all -
Alternative names
- AA408978 antibody
- ARHG2 antibody
- ARHG2_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GEF H1 antibody (ab185697)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat lung tissue labelling GEF H1 with ab185697 at 1/200. Magnification: 400x.
-
All lanes : Anti-GEF H1 antibody (ab185697) at 1/500 dilution
Lane 1 : Mouse brain cell lysate
Lane 2 : Mouse lung cell lysate
Predicted band size: 112 kDa
Protocols
Datasheets and documents
References (0)
ab185697 has not yet been referenced specifically in any publications.