Overview

  • Product name

  • Description

    Rabbit polyclonal to Gemin 8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Gemin 8 aa 6-152.
    Sequence:

    ASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWY LPSALLPQSSYDNEAAYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSR IQASTKEDQALSKEEEMETESDAEVECDLSNMEITEELRQYFAETER


    Database link: Q9NWZ8

  • Positive control

    • IHC-P: Human thyroid gland tissue. WB: Human RT4 and U-251 MG sp cell lysates. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 29 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    Gemin 8 forms a large macromolecular complex which includes other gemin proteins, SMN (survival motor neuron) protein and Unrip. This complex is required for assembly of small nuclear ribonucleoproteins (snRNPs) from Sm proteins and snRNAs. Gemin 8 mediates the binding of SMN with gemin 6 and gemin 7.
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • FAM51A1 antibody
    • FLJ20514 antibody
    • FLJ43072 antibody
    • gem (nuclear organelle) associated protein 8 antibody

Images

  • Paraffin-embedded human thyroid gland tissue stained for Gemin 8 using ab224758 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-Gemin 8 antibody (ab224758) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 29 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Gemin 8 (green) using ab224758 at 4 µg/ml in ICC/IF.

References

ab224758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up