Overview

  • Product name

  • Description

    Rabbit polyclonal to Gemin 8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Gemin 8 aa 1-124.
    Sequence:

    MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCF NLPWYLPSALLPQSSYDNEAAYPQSFYDHHVAWQDYPCSSSHFRRSGQHP RYSSRIQASTKEDQALSKEEEMET


    Database link: Q9NWZ8

  • Positive control

    • WB: HepG2 and HEK-293 whole cell lysates; Mouse kidney tissue lysate. IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 29 kDa.

Target

  • Relevance

    Gemin 8 forms a large macromolecular complex which includes other gemin proteins, SMN (survival motor neuron) protein and Unrip. This complex is required for assembly of small nuclear ribonucleoproteins (snRNPs) from Sm proteins and snRNAs. Gemin 8 mediates the binding of SMN with gemin 6 and gemin 7.
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • FAM51A1 antibody
    • FLJ20514 antibody
    • FLJ43072 antibody
    • gem (nuclear organelle) associated protein 8 antibody

Images

  • All lanes : Anti-Gemin 8 antibody (ab235092) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal rabbit IgG at 1/50000 dilution

    Predicted band size: 29 kDa

  • Paraffin-embedded human adrenal gland tissue stained for Gemin 8 using ab235092 at 1/100 dilution in immunohistochemical analysis.

References

ab235092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up